DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Fpr2

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_032065.1 Gene:Fpr2 / 14289 MGIID:1278319 Length:351 Species:Mus musculus


Alignment Length:329 Identity:94/329 - (28%)
Similarity:166/329 - (50%) Gaps:45/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NGSHYLEYDDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILN 186
            |||..:.||.       :.:.:|.:::|::.::...:|:.||.|||:|. .|....|||.|:.||
Mouse    10 NGSEVVVYDS-------TISRVLWILSMVVVSITFFLGVLGNGLVIWVA-GFRMPHTVTTIWYLN 66

  Fly   187 LAIADECFLIGIPFLLYTMQV-GNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPI 250
            ||:||..|...:||||..|.: ..||||.::||...:...:..|.|...:.:::.||.|.|.||:
Mouse    67 LALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIALDRCICVLHPV 131

  Fly   251 SSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCNI---EW--PDTQNSHTDST 310
            .:..:||..:::.|....|:.:::|.||:.:|.:||:...|:|.|..   .|  .|.:..:|..|
Mouse   132 WAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNFGSWAQTDEEKLNTAIT 196

  Fly   311 FI----LYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLT-VISAYIF 370
            |:    :...::||:.|::.:.|.|.|:..|::.....:.|:..:         ||| |::::..
Mouse   197 FVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPLR---------VLTAVVASFFI 252

  Fly   371 CWLPH---------WISQVALISSAPQRCASRLELAVFL-ACGCLSYSNSAMNPILYAFLSDNFK 425
            ||.|.         |..:..|       ..|...|.:|: ....|:|.||.:||:||.|:..:|:
Mouse   253 CWFPFQLVALLGTVWFKETLL-------SGSYKILDMFVNPTSSLAYFNSCLNPMLYVFMGQDFR 310

  Fly   426 KSFM 429
            :.|:
Mouse   311 ERFI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 68/226 (30%)
7tm_1 162..417 CDD:278431 81/275 (29%)
Fpr2NP_032065.1 7tm_1 43..302 CDD:278431 81/275 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.