DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Ccr1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_034042.3 Gene:Ccr1 / 12768 MGIID:104618 Length:355 Species:Mus musculus


Alignment Length:282 Identity:79/282 - (28%)
Similarity:145/282 - (51%) Gaps:17/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGNY 215
            ||:||.|||:.||.|||.|:|:..::|::|:||:.|||::|..||..:||.:......:|.||:.
Mouse    40 LYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDA 104

  Fly   216 MCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVI 280
            |||.......:..::...|:::::.|||:|:.|.:.:.|.||.....:.|...|..::|..:|.:
Mouse   105 MCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPAL 169

  Fly   281 LFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKH 345
            .|.. .|....:.:|:..:|............|...:||...||..:::.|..:||.|     ..
Mouse   170 YFFK-AQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRIL-----LR 228

  Fly   346 KSKEKKRSHRKVTKLVLTVISAYIFCWLPHWIS------QVALISSAPQRCASRLELAVFLACGC 404
            :..|||   .|..:|:..:...:...|.|:.:|      |..|.::..:: :.:|:||:.:. ..
Mouse   229 RPSEKK---VKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQ-SKQLDLAMQVT-EV 288

  Fly   405 LSYSNSAMNPILYAFLSDNFKK 426
            ::|::..:|||:|.|:.:.|.|
Mouse   289 IAYTHCCVNPIIYVFVGERFWK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 59/215 (27%)
7tm_1 162..417 CDD:278431 68/260 (26%)
Ccr1NP_034042.3 7tm_1 51..301 CDD:278431 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.