DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and C5ar1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001167021.1 Gene:C5ar1 / 12273 MGIID:88232 Length:351 Species:Mus musculus


Alignment Length:410 Identity:92/410 - (22%)
Similarity:161/410 - (39%) Gaps:87/410 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NGSHYLEYDDDG---PDCSYSYNFILK-----LITMILYALVCIIGLFGNTLVIYVVMRFSKMQT 178
            |.|..:.||..|   |:.......:.|     :..:|:|::|.::|:.||.||::|. .|...:.
Mouse     6 NSSFEINYDHYGTMDPNIPADGIHLPKRQPGDVAALIIYSVVFLVGVPGNALVVWVT-AFEARRA 69

  Fly   179 VTNIYILNLAIADECFLIGIPFLLYTMQVGN-WPFGNYMCKAYMVSTSITSFTSSIFLLIMSADR 242
            |..|:.||||:||....:.:|.|..|:...| |.|....|........:..:.|.:.|..:||||
Mouse    70 VNAIWFLNLAVADLLSCLALPVLFTTVLNHNYWYFDATACIVLPSLILLNMYASILLLATISADR 134

  Fly   243 YIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHT 307
            ::.|..||...:.|...::.:....||:.::||.:|..::...             :.|..:.||
Mouse   135 FLLVFKPIWCQKVRGTGLAWMACGVAWVLALLLTIPSFVYREA-------------YKDFYSEHT 186

  Fly   308 -------------DSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTK 359
                         :....:..|::||..||..:.:.|..::.:..       |::..|| .|..|
Mouse   187 VCGINYGGGSFPKEKAVAILRLMVGFVLPLLTLNICYTFLLLRTW-------SRKATRS-TKTLK 243

  Fly   360 LVLTVISAYIFCWLPHWISQVALISSAPQR-CASRLELAVFLACGCLSYSNSAMNPILYAFLSDN 423
            :|:.|:..:...|||:.::.|.:....|.. ...|:|....| |..|:|.|..:|||:|......
Mouse   244 VVMAVVICFFIFWLPYQVTGVMIAWLPPSSPTLKRVEKLNSL-CVSLAYINCCVNPIIYVMAGQG 307

  Fly   424 FKKSFMKACTCAARKDVNAQLQLENSFFPKFGKGRQSERLLGGNGKGGAQRGALTKKKCLATRNN 488
            |....:::                   .|...:...||..:|.:.|                   
Mouse   308 FHGRLLRS-------------------LPSIIRNALSEDSVGRDSK------------------- 334

  Fly   489 NAPMATTTTTTTTTTGTDAV 508
               ..|.:||.|:|..:.||
Mouse   335 ---TFTPSTTDTSTRKSQAV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 53/229 (23%)
7tm_1 162..417 CDD:278431 67/269 (25%)
C5ar1NP_001167021.1 7tm_1 54..301 CDD:278431 67/269 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..351 7/43 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.