DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and Cysltr1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_446093.1 Gene:Cysltr1 / 114099 RGDID:619796 Length:339 Species:Rattus norvegicus


Alignment Length:283 Identity:74/283 - (26%)
Similarity:145/283 - (51%) Gaps:14/283 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPF-LLYTMQVGNWPFGN 214
            :|:::.::|.|||:.|:||:::....::...:|::||||||...:..:|. ::|.:..|.|.||:
  Rat    31 MYSMISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWFFGD 95

  Fly   215 YMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPV 279
            ::|:....:..:..:.|..|:..||..|.:|:..|:.:....|...::.|....|:..:|...|.
  Rat    96 FLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPF 160

  Fly   280 ILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILY-SLVLGFATPLTFILVFYCLVIRKLHTVGP 343
            :| :.:.|....|..| .|.|..:.:......:.| ||:.||..|...|:|.|.::|..|    .
  Rat   161 LL-SKSYQDEKNNTKC-FEPPQDKQTKKYVLVLHYVSLIFGFIIPFVTIIVCYTMIILTL----L 219

  Fly   344 KHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQ---VALISSAPQRCAS--RLELAVFLACG 403
            |:..|:...|.||...:::.|.:|::..::|:.|.:   :..:.|..:.|.|  |::.:|.:...
  Rat   220 KNTMKKNLPSRRKAIGMIIVVTAAFLVSFMPYHIQRAIHLHFLHSETRSCDSVLRMQKSVVITLS 284

  Fly   404 CLSYSNSAMNPILYAFLSDNFKK 426
             |:.||...:|:||.|...||::
  Rat   285 -LAASNCCFDPLLYFFSGGNFRR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 57/217 (26%)
7tm_1 162..417 CDD:278431 66/261 (25%)
Cysltr1NP_446093.1 7tm_4 35..251 CDD:304433 57/221 (26%)
7tm_1 42..297 CDD:278431 66/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.