DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and CYSLTR1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001269115.1 Gene:CYSLTR1 / 10800 HGNCID:17451 Length:337 Species:Homo sapiens


Alignment Length:303 Identity:81/303 - (26%)
Similarity:150/303 - (49%) Gaps:23/303 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPF-LLYTMQVGNWPFGN 214
            ||:::.::|.|||..|:||:::....::...:|::|||:||...:..:|. ::|.:..|.|.||:
Human    29 LYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGD 93

  Fly   215 YMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPV 279
            ::|:....:..:..:.|..|:..||..|.||:..|:.:....|...::.|....|:..:|...| 
Human    94 FLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSP- 157

  Fly   280 ILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILY--SLVLGFATPLTFILVFYCLVIRKLHTVG 342
            .|.|...:....|..| .| |...|...:...:|:  ||.:||..|...|:|.|.::|..|    
Human   158 FLMAKPQKDEKNNTKC-FE-PPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTL---- 216

  Fly   343 PKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQ---VALISSAPQRCAS--RLELAVFLAC 402
            .|...|:...||:|...:::.|.:|::..::|:.|.:   :..:.:..:.|.|  |::.:|.:..
Human   217 LKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITL 281

  Fly   403 GCLSYSNSAMNPILYAFLSDNFKK---SFMK----ACTCAARK 438
            . |:.||...:|:||.|...||:|   :|.|    :.|...||
Human   282 S-LAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 58/218 (27%)
7tm_1 162..417 CDD:278431 66/262 (25%)
CYSLTR1NP_001269115.1 7tm_4 32..>163 CDD:304433 35/131 (27%)
7tm_1 40..295 CDD:278431 66/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.