DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and LPAR6

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001155969.1 Gene:LPAR6 / 10161 HGNCID:15520 Length:344 Species:Homo sapiens


Alignment Length:332 Identity:84/332 - (25%)
Similarity:152/332 - (45%) Gaps:37/332 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NGSHYLEYDDDGPDCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILN 186
            |.||          |.|:.:|...|.. .::::|.::||..|.:.||:.:...|::..|..|::|
Human     5 NSSH----------CFYNDSFKYTLYG-CMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMIN 58

  Fly   187 LAIADECFLIGIPFLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPIS 251
            ||::|..|:..:||.::.....|||||:.:||..::......:.|.:||..:|.||::|:.:|..
Human    59 LAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFK 123

  Fly   252 SPRYRTPFVSKLVSAFAWMTSVLLMLPVILFAST-VQSSNGNVSCNIEWPDTQNSHTDSTFILYS 315
            |...||...:|:|....|:|.:....|.:...|| .|.:|.:.:|...:|:.......|..:::.
Human   124 SKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFI 188

  Fly   316 LVLGFATPLTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQV 380
            .::||..||...:....:|::.|.......:||..|   .||.|::...:..:.||::|:.|:.:
Human   189 EIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINK---TKVLKMIFVHLIIFCFCFVPYNINLI 250

  Fly   381 ALISSAPQRCASRLELAVFLACG-------------CLSYSNSAMNPILYAFLSDNFKKSFMKAC 432
            ..         |.:....|:.|.             |::.||...:||:|.|.||..:.|.....
Human   251 LY---------SLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKN 306

  Fly   433 TCAARKD 439
            ....|.|
Human   307 WSVRRSD 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 58/216 (27%)
7tm_1 162..417 CDD:278431 67/268 (25%)
LPAR6NP_001155969.1 7tmA_LPAR6_P2Y5 18..302 CDD:320284 75/296 (25%)
TM helix 1 20..44 CDD:320284 6/24 (25%)
TM helix 2 53..74 CDD:320284 8/20 (40%)
TM helix 3 90..112 CDD:320284 4/21 (19%)
TM helix 4 135..151 CDD:320284 3/15 (20%)
TM helix 5 182..205 CDD:320284 5/22 (23%)
TM helix 6 228..250 CDD:320284 5/21 (24%)
TM helix 7 270..295 CDD:320284 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X22
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.