DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and si:dkey-148a17.5

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001315622.1 Gene:si:dkey-148a17.5 / 100535037 ZFINID:ZDB-GENE-160728-121 Length:339 Species:Danio rerio


Alignment Length:329 Identity:97/329 - (29%)
Similarity:163/329 - (49%) Gaps:33/329 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGN 214
            ::.|:..::|..||.||::.:::..|.::.|.:.||:|:|||...||.:|..:|:: ..:|.||.
Zfish    27 VILAVCFLVGTPGNLLVVWTILKHVKQRSHTVLLILHLSIADLLVLITLPLWIYSL-ARSWVFGK 90

  Fly   215 YMCKAYMVSTSITSFTSSIFLL-IMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLP 278
            ..||| ||....:...||:|:: |||.:|::|:.:|.....::.......:....|:.|:||..|
Zfish    91 AACKA-MVYIIYSCMYSSVFIITIMSVERFLAIRYPFKMLSWKNETAMFRLLLVTWILSLLLGSP 154

  Fly   279 VILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFIL-YSLVLGFATPLTFILVFYCLVIRKLHTVG 342
            |||..|.....:|...|   .....||.:...|.: ...:|||..|...:.:.||.|..:|.   
Zfish   155 VILTQSLDDEDDGTGHC---LHRVYNSLSFEVFCMCLETLLGFVIPFFTLAICYCQVAAQLR--- 213

  Fly   343 PKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHW----ISQVALISSAPQRCASRLELAVFLACG 403
                 |.:.|:.:|...|:..|:.|:|.|||||.    ||.|.::....:..::..:.|:|: .|
Zfish   214 -----KVRFRAKKKSVFLIGGVVVAFILCWLPHHVLNVISLVDILRGESEEASAISDSAIFI-FG 272

  Fly   404 CLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQ-LQLENSFFPKFGKGRQSERLLGGN 467
            .|::.:|::||:||||.|..|..|..||......:|:..| ||:            :.|.|.||.
Zfish   273 SLAFISSSVNPVLYAFASRTFHGSLKKAGIVKLFQDLGTQTLQM------------KEEALQGGG 325

  Fly   468 GKGG 471
            .:.|
Zfish   326 PQDG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 63/217 (29%)
7tm_1 162..417 CDD:278431 77/260 (30%)
si:dkey-148a17.5NP_001315622.1 7tm_4 33..276 CDD:304433 75/256 (29%)
7tm_1 39..286 CDD:278431 77/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.