DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and gpr183b

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001124284.1 Gene:gpr183b / 100150688 ZFINID:ZDB-GENE-081031-74 Length:366 Species:Danio rerio


Alignment Length:388 Identity:83/388 - (21%)
Similarity:169/388 - (43%) Gaps:46/388 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 DCS-YSYNFILKLITMILYALVCIIGLFGNTLVIYVVM-RFSKMQTVTNIYILNLAIADECFLIG 197
            :|: |.:..:.:::..::|:::|.:||.||.|.::||: ..:|:.::| :|..|||::|..|.:.
Zfish    13 NCNLYDHRPVARVLIPLVYSIICPVGLLGNALALHVVISSTTKINSIT-LYSANLAVSDILFCLS 76

  Fly   198 IPFLLYTMQVG-NWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVS 261
            :|.......:| :||.|..:|||..:...:..:....|:..::.||::|:..|....:.|.....
Zfish    77 LPLRAVYYGLGFHWPMGEVLCKAIALLFYLNCYAGVNFMTCLAVDRFVALVFPARLAKLRKAKNV 141

  Fly   262 KLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDSTFIL-YSLVLGFATPLT 325
            :.|....|:..:...||::....|....:.:::| :|:|:.:.......::| .::||||..|:.
Zfish   142 RFVCLAIWLLVLAQTLPLLTIGLTKTEPDSSITC-MEYPNFEGVFKGLPYMLIVAVVLGFGIPVM 205

  Fly   326 FILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQV-----ALISS 385
            .|:..|.::..|||.....::..|:....:|...::..|:..::.|:.|:.|..:     .|:..
Zfish   206 TIIACYSILTHKLHQAAKSNQLTERSGKTKKARGVIAGVVFVFVVCFSPYHIDILQYMIRKLLYE 270

  Fly   386 APQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENSF 450
            ...:.....::::.:.. ||...||.::|.:|.|....:|:..|:.          .:.|:...|
Zfish   271 TDCKELQSFQISLHITV-CLMNLNSCLDPFVYFFACKGYKQKVMRM----------MKWQVGTHF 324

  Fly   451 FPKFGKGRQSERLLGGNGKGGAQRGALTKKKCLATRNNNAPMATTTTTTTTTTGTDAVTCLQP 513
            .........|     |.|            ..|.||.||       .......|.|...|.||
Zfish   325 SSVKNSAESS-----GTG------------DVLGTRRNN-------RIIMNNVGEDQQICYQP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 52/218 (24%)
7tm_1 162..417 CDD:278431 58/262 (22%)
gpr183bNP_001124284.1 7tm_4 33..>151 CDD:304433 32/118 (27%)
7tm_1 41..301 CDD:278431 58/262 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.