DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and hcar1-2

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001156767.1 Gene:hcar1-2 / 100005313 ZFINID:ZDB-GENE-111111-6 Length:310 Species:Danio rerio


Alignment Length:318 Identity:74/318 - (23%)
Similarity:138/318 - (43%) Gaps:46/318 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 CSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIADECFLIGIPF 200
            |:|....:...:..:|:: ..::||.||.|.:.:...........:||:.:||:||...|..:||
Zfish     8 CTYETPLLDAYLPPVLFS-EFVLGLMGNGLALCMFFFHRDSWKPNSIYLAHLALADSLVLFCLPF 71

  Fly   201 LL-YTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLV 264
            .. |..:..:|.:|:..|:..:...:........||..::.|||:.:.||::.........:..|
Zfish    72 RADYYRRGKHWVYGDAFCRVLLFLLAANRAAGIFFLTAVAVDRYLKIVHPLNRINQMGLRYALWV 136

  Fly   265 SAFAWMTSVLLMLPVILFAST-VQSSNGNVSC---NIEWPDTQNSHTDSTFILYSL--VLGFATP 323
            |...|  ::::.:.|.|.|.. ....|.:..|   ||.:      .::|.|..:::  |:.|..|
Zfish   137 SVGLW--ALIIAMTVYLLADKHFYYLNNHTQCESFNICF------GSNSRFTWHNVFYVIQFFVP 193

  Fly   324 LTFILVFYCLVIRKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVAL------ 382
             |||:::....|    |...|.|:.:|....|:..:.||.|...:|.|:.|..||::::      
Zfish   194 -TFIVIYCSTCI----TWQLKGKTIDKHGKIRRAVRFVLAVALVFIICFFPSNISRISMYVLKLW 253

  Fly   383 ------ISSAPQRCASRLELAVFLACGCLSYSNSAMNPILYAF----LSDNFKKSFMK 430
                  .|.|..         .|....|.:|.||.:||::|.|    :|.:.:|.:|:
Zfish   254 YNECQYFSDAND---------AFKTTVCFTYFNSVLNPVVYYFSSPAVSGSLRKIYMR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 53/222 (24%)
7tm_1 162..417 CDD:278431 64/273 (23%)
hcar1-2NP_001156767.1 7tm_1 33..285 CDD:278431 64/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.