DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstC-R2 and c5ar1

DIOPT Version :9

Sequence 1:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_005159331.1 Gene:c5ar1 / 100000959 -ID:- Length:346 Species:Danio rerio


Alignment Length:322 Identity:85/322 - (26%)
Similarity:147/322 - (45%) Gaps:26/322 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NGSHYLEYD---DDGP---DCSYSYNFILKLITMILYALVCIIGLFGNTLVIYVVMRFSKMQTVT 180
            |.|.:..||   |..|   :.|.|:......||::.|.:|.::|:.||.||::|. .|....:|.
Zfish     4 NNSDWTSYDFGNDTIPSPNEISLSHIGTRHWITLVCYGIVFLLGVPGNALVVWVT-GFRMPNSVN 67

  Fly   181 NIYILNLAIADECFLIGIPFLLYTM-QVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYI 244
            ..:.|||||||....:.:|.|:..: |..:||||...||.:.....:..:.|.:.|:::|.||::
Zfish    68 AQWFLNLAIADLLCCLSLPILMVPLAQDQHWPFGALACKLFSGIFYMMMYCSVLLLVVISLDRFL 132

  Fly   245 AVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFASTVQSSNGNVSCNIEWPDTQNSHTDS 309
            .|..|:.....|.|..::::....|:..:|...|..........|.....|...:  :...|..:
Zfish   133 LVTKPVWCQNNRQPRQARILCFIIWILGLLGSSPYFAHMEIQHHSETKTVCTGSY--SSLGHAWA 195

  Fly   310 TFILYSLVLGFATPLTFILVFYCLVI---RKLHTVGPKHKSKEKKRSHRKVTKLVLTVISAYIFC 371
            ..|:.|.       |.|:|.|..:.|   :..|......:.::|.   .:..:::|.::..:..|
Zfish   196 ITIIRSF-------LFFLLPFLIICISHWKVYHMTSSGRRQRDKS---SRTLRVILALVLGFFLC 250

  Fly   372 WLP-HWISQVALISSAP-QRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKA 431
            |.| |.:..:.|:|..| :|....|.||..|.. ||:|.||.:||:||..|...||::.:.:
Zfish   251 WTPLHIVDLLILVSDQPSERFEVNLNLAHVLTL-CLAYINSCLNPLLYVCLGRGFKENLISS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 49/219 (22%)
7tm_1 162..417 CDD:278431 67/260 (26%)
c5ar1XP_005159331.1 7tm_1 50..297 CDD:278431 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.