DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4306 and GGCT

DIOPT Version :9

Sequence 1:NP_649038.1 Gene:CG4306 / 40017 FlyBaseID:FBgn0036787 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_076956.1 Gene:GGCT / 79017 HGNCID:21705 Length:188 Species:Homo sapiens


Alignment Length:208 Identity:72/208 - (34%)
Similarity:109/208 - (52%) Gaps:33/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LPKGNCHSISGLNSTLNLPEIRGDQFLYFGFGSNMLIKRIHIQNPSAVRIGPALLPDYRLDFALE 81
            :....|..::|.:.         :.||||.:|||:|.:|||::||||.....|.|.|::|||. .
Human     1 MANSGCKDVTGPDE---------ESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFG-N 55

  Fly    82 SAG-----WSGSVATIVPTQGDHVWGTLWKIDLSNLPDIDSQEGVSQGIYEPRTVYVKLHGESES 141
            |.|     |.|.:|||..:.||.|||.:||::.|||..:|.||||..|:|....|.|... |.:.
Human    56 SQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQ-EGKE 119

  Fly   142 TPARAYLLTKQPESNLYELPKDSIPLSRQPSKTYLQCLVKGAIESSVPEDYVQRLRSIKHN---G 203
            ...|:||:|.      ||        |..||..|.:.:..||.|:.:|.:|.::|::|:.|   |
Human   120 ITCRSYLMTN------YE--------SAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTG 170

  Fly   204 QVNSYLERKLELG 216
            :|:..:|..::.|
Human   171 KVSEEIEDIIKKG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4306NP_649038.1 AIG2_2 99..196 CDD:290488 33/96 (34%)
GGCTNP_076956.1 Substrate binding. /evidence=ECO:0000305|PubMed:18515354 19..24 2/4 (50%)
AIG2_2 78..160 CDD:372719 33/96 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147197
Domainoid 1 1.000 62 1.000 Domainoid score I10350
eggNOG 1 0.900 - - E1_KOG4059
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11437
Inparanoid 1 1.050 116 1.000 Inparanoid score I4823
Isobase 1 0.950 - 0 Normalized mean entropy S4447
OMA 1 1.010 - - QHG63765
OrthoDB 1 1.010 - - D1484710at2759
OrthoFinder 1 1.000 - - FOG0003477
OrthoInspector 1 1.000 - - otm40775
orthoMCL 1 0.900 - - OOG6_105402
Panther 1 1.100 - - O PTHR12935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3715
SonicParanoid 1 1.000 - - X2366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.