DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4306 and ggct

DIOPT Version :9

Sequence 1:NP_649038.1 Gene:CG4306 / 40017 FlyBaseID:FBgn0036787 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001037865.1 Gene:ggct / 613056 XenbaseID:XB-GENE-990757 Length:189 Species:Xenopus tropicalis


Alignment Length:173 Identity:67/173 - (38%)
Similarity:93/173 - (53%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPEIRGDQFLYFGFGSNMLIKRIHIQNPSAVRIGPALLPDYRLDFALESAG----WSGSVATIVP 94
            |||  |:.|.||.:|||:|.:|:.:.||||.....|.|.::||.|......    |.|.|||:|.
 Frog    10 LPE--GNSFYYFAYGSNLLKERLLLHNPSASFRCIASLKNFRLAFGNNEGNRISTWGGGVATVVE 72

  Fly    95 TQGDHVWGTLWKIDLSNLPDIDSQEGVSQGIYEPRTVYVKLHGESESTPARAYLLTKQPESNLYE 159
            :|||.|||.:||:|::||..:|.||||..|||||..:.|:.  ..|:.|.|.           |:
 Frog    73 SQGDEVWGVVWKMDITNLHSLDMQEGVDVGIYEPLEINVQT--AEENLPCRC-----------YQ 124

  Fly   160 LPKDSIPLSRQPSKTYLQCLVKGAIESSVPEDYVQRLRSIKHN 202
            :.|....||   |..|.|.|..||.::.:|..|.:.|:.|:.|
 Frog   125 MKKCIFGLS---SPQYKQVLCMGAKQNDLPLKYQKMLKEIETN 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4306NP_649038.1 AIG2_2 99..196 CDD:290488 34/96 (35%)
ggctNP_001037865.1 AIG2_2 77..158 CDD:372719 34/96 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10960
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4795
OMA 1 1.010 - - QHG63765
OrthoDB 1 1.010 - - D1484710at2759
OrthoFinder 1 1.000 - - FOG0003477
OrthoInspector 1 1.000 - - otm47963
Panther 1 1.100 - - O PTHR12935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3715
SonicParanoid 1 1.000 - - X2366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.