DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4306 and Ggct

DIOPT Version :9

Sequence 1:NP_649038.1 Gene:CG4306 / 40017 FlyBaseID:FBgn0036787 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001102099.1 Gene:Ggct / 362368 RGDID:1304876 Length:188 Species:Rattus norvegicus


Alignment Length:189 Identity:68/189 - (35%)
Similarity:102/189 - (53%) Gaps:22/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GDQFLYFGFGSNMLIKRIHIQNPSAVRIGPALLPDYRLDF----ALESAGWSGSVATIVPTQGDH 99
            |:.||||.:|||:|.:|||::|||||....|.|.|::|||    ...|..|.|.:|||..:.||.
  Rat    14 GETFLYFAYGSNLLTERIHLRNPSAVFCCVARLQDFKLDFGNFQGKMSERWHGGIATIFQSPGDE 78

  Fly   100 VWGTLWKIDLSNLPDIDSQEGVSQGIYEPRTVYVKLHGESESTPARAYLLTKQPESNLYELPKDS 164
            |||.:||::.|||..:|.||||..|:|....:.|... :.:....|:||:|.      ||     
  Rat    79 VWGVVWKMNKSNLSSLDEQEGVKSGVYVVIEIKVTTQ-QGKDITCRSYLMTN------YE----- 131

  Fly   165 IPLSRQPSKTYLQCLVKGAIESSVPEDYVQRLRSIKHN---GQVNSYLERKLELGGVTL 220
               ...||..|.:.:..||.|:.:|.:|.::|..|:.|   |:::..:|..::.|...|
  Rat   132 ---RAPPSPQYKKVICMGAKENGLPLEYQEKLNVIEPNDYKGKISDEMEDIIKKGEAKL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4306NP_649038.1 AIG2_2 99..196 CDD:290488 30/96 (31%)
GgctNP_001102099.1 AIG2_2 78..160 CDD:372719 30/96 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340855
Domainoid 1 1.000 63 1.000 Domainoid score I9999
eggNOG 1 0.900 - - E1_KOG4059
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11437
Inparanoid 1 1.050 115 1.000 Inparanoid score I4735
OMA 1 1.010 - - QHG63765
OrthoDB 1 1.010 - - D1484710at2759
OrthoFinder 1 1.000 - - FOG0003477
OrthoInspector 1 1.000 - - otm44914
orthoMCL 1 0.900 - - OOG6_105402
Panther 1 1.100 - - O PTHR12935
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.