DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4306 and CG32196

DIOPT Version :9

Sequence 1:NP_649038.1 Gene:CG4306 / 40017 FlyBaseID:FBgn0036787 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_730334.2 Gene:CG32196 / 317908 FlyBaseID:FBgn0052196 Length:195 Species:Drosophila melanogaster


Alignment Length:180 Identity:98/180 - (54%)
Similarity:123/180 - (68%) Gaps:1/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FLYFGFGSNMLIKRIHIQNPSAVRIGPALLPDYRLDFALESAGWSGSVATIVPTQGDHVWGTLWK 106
            |.|||||||||..|||||||:|.|||...|.::||||...|..|.|:.||||||||.||:|.:|:
  Fly    15 FFYFGFGSNMLASRIHIQNPTAKRIGVGKLENFRLDFHTGSKNWLGAPATIVPTQGSHVYGAIWE 79

  Fly   107 IDLSNLPDIDSQEGVSQGIYEPRTVYVKLHGESESTPARAYLLTKQPESNLYE-LPKDSIPLSRQ 170
            ||:.||.|:|.||.|..|:|.|.:|.|.|.....|...|||.||.||:::|:. ..::.||..||
  Fly    80 IDMCNLKDLDDQESVPAGVYVPISVPVHLLNTDSSITCRAYHLTNQPQTDLHAGGGQEIIPHDRQ 144

  Fly   171 PSKTYLQCLVKGAIESSVPEDYVQRLRSIKHNGQVNSYLERKLELGGVTL 220
            ||:|||:.|||||.||.||::|::.||.|||||:....:|.||||..|.|
  Fly   145 PSQTYLKVLVKGATESGVPDEYIEWLRGIKHNGKQVPAMEAKLELDKVQL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4306NP_649038.1 AIG2_2 99..196 CDD:290488 47/97 (48%)
CG32196NP_730334.2 GGCT_like 17..120 CDD:119400 57/102 (56%)
AIG2_2 72..170 CDD:290488 47/97 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449125
Domainoid 1 1.000 58 1.000 Domainoid score I10741
eggNOG 1 0.900 - - E1_KOG4059
Homologene 1 1.000 - - H11437
Inparanoid 1 1.050 118 1.000 Inparanoid score I4777
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108958at33392
OrthoFinder 1 1.000 - - FOG0003477
OrthoInspector 1 1.000 - - mtm6381
orthoMCL 1 0.900 - - OOG6_105402
Panther 1 1.100 - - P PTHR12935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3715
SonicParanoid 1 1.000 - - X2366
1312.830

Return to query results.
Submit another query.