DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5103 and CG17691

DIOPT Version :9

Sequence 1:NP_649036.1 Gene:CG5103 / 40012 FlyBaseID:FBgn0036784 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001015354.3 Gene:CG17691 / 3355069 FlyBaseID:FBgn0039993 Length:364 Species:Drosophila melanogaster


Alignment Length:291 Identity:64/291 - (21%)
Similarity:98/291 - (33%) Gaps:62/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 AADNPRVIALDGDTKNSTYAD------------KMRNAF-PERFIECFTAQQNLVGVAVGATCRR 381
            |.:|...:|||.:.....:.:            .:|:.: .:|.......:|.:.|.|:|.....
  Fly    48 AINNAMDLALDENKSALLFGEDVGFGGVFRCSVNLRDKYGSQRVFNTPLCEQGIAGFAIGVANTG 112

  Fly   382 RTVAFVSTYATFFTRAFDQIRMGAISHTNVNFAGSH---------CG-------CSIGEDGPSQM 430
            .|......:|.:...:||||         ||.|..:         ||       |.....|....
  Fly   113 ATAIAEIQFADYIFPSFDQI---------VNEAAKYRYRSGGLFDCGSLTFRVPCGAVGHGALYH 168

  Fly   431 GLEDMAMFRSIPGSTVFYPTDAVSTERAVELAANTKGVCYI---RTTYPSTTVIYNNDEV----F 488
            .....|.|...||..|..|...:..:..:.........|.:   :|.|.:..     :||    :
  Fly   169 SQSPEAYFAHTPGLRVVVPRGPIKAKGLILACIRDPNPCIVFEPKTLYRAAV-----EEVPAEYY 228

  Fly   489 AVGLGKVVRQKPSDEVLLIGAGVTLYECLAAAE----RLEEDCITARVIDPFTVKPLDVGLIVKH 549
            ...|||....:...:|.|||.|..::..|..||    .|..||   .|||..::.|.|...|...
  Fly   229 TSQLGKADILRHGKDVTLIGWGTQVHVLLEVAEIAKSTLNIDC---EVIDLVSILPWDAITICTS 290

  Fly   550 GKLCRGRIVVVEDHYQQGGLGEAVLSALADY 580
            .|. .||:::..:.....|.|    |.||.|
  Fly   291 AKK-TGRVIIAHEAPLTQGFG----SELASY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5103NP_649036.1 PRK05899 12..621 CDD:235639 64/291 (22%)
TPP_TK 19..263 CDD:238970
TPP_PYR_DXS_TK_like 321..474 CDD:132916 31/175 (18%)
Transketolase_C 493..613 CDD:280875 28/92 (30%)
CG17691NP_001015354.3 PTZ00182 10..362 CDD:185502 64/291 (22%)
TPP_PYR_E1-PDHc-beta_like 48..213 CDD:132919 31/173 (18%)
Transketolase_C 233..353 CDD:280875 28/92 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.