DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA75a and CheA56a

DIOPT Version :9

Sequence 1:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001027438.1 Gene:CheA56a / 3772206 FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster


Alignment Length:180 Identity:50/180 - (27%)
Similarity:101/180 - (56%) Gaps:8/180 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WLVIIVLLQLLEKIKCEQS-YEVTNERLEPFEGDSQTLVLFDGLKTIGRERALNGSFKFLGEMNN 66
            |::..:|:.....:..::| |||..|.::..:|.::||.|:. |:.:||.|.:||:..||.:: :
  Fly     5 WMIQSLLILWTVSVGSKKSNYEVRFESIDAVKGSTETLFLYQ-LRLLGRNRMINGTLIFLEDL-D 67

  Fly    67 DDFKVSVELYSSPNGDGEFKRMVMDVPQTSICECFKKFYVQFVQPSLKTGETTNFPVVDDDFCPV 131
            :.|.|..|.::..|  |.:.:.:::...:..||.|.::|:.|.   |.....:|.|....:.||.
  Fly    68 ETFDVLFESHAFKN--GYWVKGIVNAAASKPCEFFNRYYISFF---LVKSTESNLPTTGAEMCPF 127

  Fly   132 PEGEFYVKNVILNTQDWPSQVPRGIVKAIITFFSGGKNVGGLIVEVKIED 181
            .:|.::|||.:::|:|||..|.:|:.:..|::...|:.|||:.:.:.|.:
  Fly   128 RKGTYFVKNGVVSTEDWPPIVFKGLNRFTISYLKNGECVGGVQLTISIAE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA75aNP_649035.2 DM8 85..180 CDD:214778 25/94 (27%)
CheA56aNP_001027438.1 DUF1091 97..179 CDD:301369 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 1 1.000 - - otm74819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.