DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA75a and CG18538

DIOPT Version :9

Sequence 1:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_611314.2 Gene:CG18538 / 37095 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster


Alignment Length:126 Identity:25/126 - (19%)
Similarity:49/126 - (38%) Gaps:10/126 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ERALNGSFKFLGEMNNDDFK------VSVELYSSPNGD-GEFKRMVMDVPQTSICECFKKFYVQF 108
            ||...|.|.....::....:      |...:..|..|| .::|.:...:|:.|:.|....:|...
  Fly    43 ERINRGVFGLTPRLSGTTIRLMKPWYVEANVLRSSTGDVSDYKLLPWAIPKQSLYEHLNTYYKDV 107

  Fly   109 VQPSLKTGETTNFPVVDDDF-CPVPEGEFYVKNVILNTQDWPSQVPRGIVKAIITFFSGGK 168
            ...:.|  ..:|.|..:..| .|:|:..::....:::....|..||.|....:|..:..|:
  Fly   108 SMKNFK--HCSNIPQFEGKFQPPLPKQTYFGNKCVIDGDGLPEIVPAGFYLIVIKCYGPGQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA75aNP_649035.2 DM8 85..180 CDD:214778 17/85 (20%)
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.