DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA75a and CG14502

DIOPT Version :9

Sequence 1:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster


Alignment Length:178 Identity:45/178 - (25%)
Similarity:83/178 - (46%) Gaps:12/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVLLQLLEKIKCEQSYEVTNERLEPFEGDSQTLVLFDGLKTIGR-ERALNGS--FKFLGEMNNDD 68
            :::|.::::...::.::.....:|.:..|...|.:...::.:|| |.||:|:  ||:..|   |:
  Fly    13 VLILLIVDQCNGKRKWDYEPLSIETYTTDETKLKIAAKVERVGRGEYALSGNIEFKYTPE---DN 74

  Fly    69 FKVSVELYSSPNGD-GEFKRMVMDVPQTSICECFKKFYVQFVQPSLKTGETTNFPVVDDDF-CPV 131
            ..|....|.|.:|| .::|.|...:|:....|.....|...|.|:|  |:.:|....|..| .|.
  Fly    75 TMVEAMAYRSTSGDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNL--GDCSNLIKFDGKFEPPW 137

  Fly   132 PEGEFYVKNVILNTQDWPSQVPRGIVKAIITFFSGGKNVGGLIVEVKI 179
            |:..:.::..:.|:..:|..||.|..|  :.|........|.|:.|||
  Fly   138 PQDTYVLEKCVANSDGFPDMVPEGYYK--VNFTLTNPVDWGFILIVKI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA75aNP_649035.2 DM8 85..180 CDD:214778 26/96 (27%)
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459078
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.