DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA75a and CheA7a

DIOPT Version :9

Sequence 1:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_572395.2 Gene:CheA7a / 31672 FlyBaseID:FBgn0029948 Length:177 Species:Drosophila melanogaster


Alignment Length:191 Identity:46/191 - (24%)
Similarity:85/191 - (44%) Gaps:33/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVIIVLLQLLEKIKCEQSYEV------TNERLEPFEG--DSQTLVLFDGLKTIGRER-ALNGSFK 59
            :.:::.:.|:...:.|:.|.|      .::.:|..|.  |..||    .:|.:.|.: .::|.|:
  Fly     4 ITLLLSILLVHSCRAEKPYSVELNTFTMDDTIENQENWVDWGTL----SMKKVSRNQFVVSGDFE 64

  Fly    60 FLGEMNNDDFKVSVELYSSPNGDGEFKRMVMDVPQTSICECFKKFYVQFVQ------PSLKTGET 118
            |...| .|:.|:.:.:|...:...:...|||.|         ||.:.||::      ||::  :.
  Fly    65 FKLNM-ADEQKIVLMVYVYDSNANQRGSMVMAV---------KKPFCQFIKEDEDSYPSIQ--KA 117

  Fly   119 TNFPVVDDDFCPVPEGEFYVKNVILNTQDWPSQVPRGIVKAIITFFSGGKNVGGLIVEVKI 179
            :|.|  |.|.||.|:|::.:.|..|.|...|...|:|.....::.......|.||:..|.:
  Fly   118 SNLP--DQDTCPFPKGKYTIDNYELETNFLPDNAPKGDYLLQLSLLDREVPVAGLVATVTL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA75aNP_649035.2 DM8 85..180 CDD:214778 28/101 (28%)
CheA7aNP_572395.2 DM8 89..177 CDD:214778 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459077
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29K9Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.