DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp312a1 and CYP97A3

DIOPT Version :9

Sequence 1:NP_001262008.1 Gene:Cyp312a1 / 40005 FlyBaseID:FBgn0036778 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:454 Identity:111/454 - (24%)
Similarity:212/454 - (46%) Gaps:41/454 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KLWMGTKLYLVDCNP-------KDIQALCSAQQLLQKTNDYRVFENWLCEGLFTSGFEKWSHRRK 132
            :|..|.|.:|:..:|       || .|...::.:|.:..|:     .:.:||..:..|.|..||:
plant   144 RLTFGPKSFLIVSDPSIAKHILKD-NAKAYSKGILAEILDF-----VMGKGLIPADGEIWRRRRR 202

  Fly   133 IVMPAFNYTMIKQFVAVFEKQSRILLTNVAKFAESGDQIDFLQLISCFTLDTICETALGVSVGSQ 197
            .::||.:...:...:::|.:.|..|...:...|..|::::...|.|..|||.|.:........|.
plant   203 AIVPALHQKYVAAMISLFGEASDRLCQKLDAAALKGEEVEMESLFSRLTLDIIGKAVFNYDFDSL 267

  Fly   198 SSAKSEYLDAVKSIL-VIIDKRLKNIFYRNSFIFKRTSHYKRE-QELIKTLHGFTEGIIQ--KRI 258
            :: .:..::||.::| ...|:.:..|...:..|:|..|..:|: ...:|.::...:.:|.  ||:
plant   268 TN-DTGVIEAVYTVLREAEDRSVSPIPVWDIPIWKDISPRQRKVATSLKLINDTLDDLIATCKRM 331

  Fly   259 DEINQDAENRNYQSSDAELDGVKRTLCFLDTLLLSKGPDGKPLTVKDIREEVDTIIFGGFDLTAT 323
            .|..:...:..|.:        :|....|..||.|    |..::.|.:|:::.|::..|.:.:|.
plant   332 VEEEELQFHEEYMN--------ERDPSILHFLLAS----GDDVSSKQLRDDLMTMLIAGHETSAA 384

  Fly   324 TLNFFMYNMTLHPEHQQRCREEVWSVCGKDKSEPISIEQVRQLEFLEACIKETLRMYPSGPLTAR 388
            .|.:..|.:|..|....:.:|||.||.| |:..  :|:.:::|::....:.|:||:||..|:..|
plant   385 VLTWTFYLLTTEPSVVAKLQEEVDSVIG-DRFP--TIQDMKKLKYTTRVMNESLRLYPQPPVLIR 446

  Fly   389 KATANCTINDFFIPKGSDVIISPIYMGRCKDFFPDPMVFKPDRWAI-GAEPK--IEATTFIPFMA 450
            ::..|..:.::.|.:|.|:.||...:.|....:.|...|.|:||.: |..|.  .:..:::||..
plant   447 RSIDNDILGEYPIKRGEDIFISVWNLHRSPLHWDDAEKFNPERWPLDGPNPNETNQNFSYLPFGG 511

  Fly   451 GARSCMGQRYAMVMLKMVLAHLLRNFLFEPLGERQVKLKLNFVITLHTVE----PYLCRAKNLD 510
            |.|.|:|..:|.....:.:|.|:|.|.|: :......:|:....|:||.|    ....|.|.||
plant   512 GPRKCIGDMFASFENVVAIAMLIRRFNFQ-IAPGAPPVKMTTGATIHTTEGLKLTVTKRTKPLD 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp312a1NP_001262008.1 p450 35..505 CDD:278495 107/447 (24%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 111/454 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53736
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.