DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp312a1 and CYP72C1

DIOPT Version :10

Sequence 1:NP_649030.1 Gene:Cyp312a1 / 40005 FlyBaseID:FBgn0036778 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:56 Identity:11/56 - (19%)
Similarity:22/56 - (39%) Gaps:9/56 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 DVLKEIAEAKEKTVAQVSMRWAY--------EQGVSMVVKSFT-KERLEENLKIFD 282
            :.::||...:..||.....|..|        |..:..:....| .|.|::::.:.|
plant    14 NTIQEILNEEPLTVPSPPSRGGYSLFHIRKAEMDIQRIFNFMTGSEDLKDDISVLD 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp312a1NP_649030.1 CYP4 75..504 CDD:410721 11/56 (20%)
CYP72C1NP_001319024.1 cytochrome_P450 84..>292 CDD:477761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.