DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp312a1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_001262008.1 Gene:Cyp312a1 / 40005 FlyBaseID:FBgn0036778 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:497 Identity:139/497 - (27%)
Similarity:230/497 - (46%) Gaps:68/497 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLALSLYLLYVFERQSRIDRLTHKWPAPPALPFIGH--------LHILAKLVGPHPLRRATEM 64
            :|:.|:.|||     |:.|:.|....:|.|||...:||        :..|.::|..||.      
Mouse    25 VLMQAMKLYL-----RRQRLLRDLSPFPGPPAHWLLGHQKFLQEDNMETLDEIVKKHPC------ 78

  Fly    65 INEHLHDHRAKLWMG-------------TKLYLVDCNPKDIQALCSAQQLLQKTNDYRVFENWLC 116
                    ....|:|             .|::|...:|| :|.|   .|||...         :.
Mouse    79 --------AFPCWVGPFQAFFYIYDPDYAKIFLSRTDPK-MQYL---HQLLTPC---------IG 122

  Fly   117 EGLFTSGFEKWSHRRKIVMPAFNYTMIKQFVAVFEKQSRILLTNVAK-FAESGDQIDFLQLISCF 180
            .||......:|...|.::.|||:..::|..|.......:::|....| :......|:..:.|:..
Mouse   123 RGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEVFEHINLM 187

  Fly   181 TLDTICETALGVSVGSQSSAKSE-YLDAVKSILVIIDKRLKNIFYRNSFIFKRTSHYKREQELIK 244
            |||.|.:.|.|.....|.:...| |:.|...:..||..||.|.::.:..|||.:......|||.|
Mouse   188 TLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGK 252

  Fly   245 TLHGFTEGIIQKRIDEINQDAENRNYQSSDAELDGVKRTLCFLDTLLLSKGPDGKPLTVKDIREE 309
            .:|.:||.|||.|          :....:..:.|..:.:..|||.:|.::..|.:..:..|:|.|
Mouse   253 VIHQYTEKIIQDR----------KKILKNQVKQDDTQTSQIFLDIVLSAQAEDERAFSDADLRAE 307

  Fly   310 VDTIIFGGFDLTATTLNFFMYNMTLHPEHQQRCREEVWSVCGKDKSEPISIEQVRQLEFLEACIK 374
            |:|.::.|.|.:|.::::.:|.:.|:||||.|||.|:.|:.|...|  |:.||:.::.:...|||
Mouse   308 VNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSS--ITWEQLDEMSYTTMCIK 370

  Fly   375 ETLRMYPSGPLTARKATANCTIND-FFIPKGSDVIISPIYMGRCKDFFPDPMVFKPDRWAIGAEP 438
            ||||:.|..|..:|:.:...|:.| ..:|.|..|::|...:......:.||.||.|.|:......
Mouse   371 ETLRLIPPVPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSD 435

  Fly   439 KIEATTFIPFMAGARSCMGQRYAMVMLKMVLAHLLRNFLFEP 480
            :.....|:||.:|.|:|:||::||:.||:.:|.:|.:|...|
Mouse   436 QRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQVAP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp312a1NP_001262008.1 p450 35..505 CDD:278495 131/470 (28%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 131/470 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.