DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpIIIC53 and AT4G25180

DIOPT Version :9

Sequence 1:NP_649028.3 Gene:RpIIIC53 / 40002 FlyBaseID:FBgn0036775 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_194248.2 Gene:AT4G25180 / 828621 AraportID:AT4G25180 Length:311 Species:Arabidopsis thaliana


Alignment Length:302 Identity:62/302 - (20%)
Similarity:110/302 - (36%) Gaps:94/302 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 SVTRKRVDRKDDKSQAERIKELLGESDASGGELSEEEANKTEMALRPILLKEGLWVTQKTPIAKQ 217
            |.|....|.::.|:..:..:.::|....     :|.:|:..|:|.:|.|          :|:|.:
plant    29 SNTEAEEDEENIKASRQFDRRIVGRRPK-----TETKASSPEVAFQPSL----------SPLAIR 78

  Fly   218 EI------------------ASSTSTLKDTLAVAQHLQQLH--VAAQAASLEEP----------- 251
            ..                  ||....:....|..:..:::|  |........||           
plant    79 SFGVPKEDDKPNSDVNPSSPASILPAVSSVTAAQEDGEEVHNFVTRTGDDYVEPWDYRNSYYPTV 143

  Fly   252 -PL--------------QYGRYPR-------TIGN-------FLDSSEAQIFLMQLPDVLPCVGD 287
             ||              ::|...:       ||.:       .:..|:.|:|:.::||.||.|  
plant   144 LPLRKPNSGDIELLDQEEFGEVAKNRDYDENTINSAEELGLTSVQHSKKQMFIFKIPDCLPVV-- 206

  Fly   288 DSEDPEPSKGDHQATSESEPASPADKCSNGPKGSVLRQLEEGQIGKILRYKSGRVKLQLGDTRFD 352
                    |....||::......:...||..:|     |.||.:||:|.||||.|||::||..||
plant   207 --------KQTTGATTKRSVREYSSGISNPFEG-----LPEGFMGKMLVYKSGAVKLKVGDALFD 258

  Fly   353 LDMGLDPGFLQELMSVTANREQRSGNMINLGPIQAKLKATPD 394
            :..|.......:::::    :.:..|...:|.....:..|||
plant   259 VSPGPGTKIPNDVVAI----DIKGRNCSRIGSSAKFVTVTPD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpIIIC53NP_649028.3 RNA_pol_Rpc4 272..395 CDD:282926 36/123 (29%)
AT4G25180NP_194248.2 RNA_pol_Rpc4 232..297 CDD:368299 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4281
eggNOG 1 0.900 - - E1_KOG3122
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003960
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13408
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.