DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS26 and Mrps26

DIOPT Version :9

Sequence 1:NP_524134.1 Gene:mRpS26 / 40001 FlyBaseID:FBgn0036774 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_997090.1 Gene:Mrps26 / 99045 MGIID:1333830 Length:200 Species:Mus musculus


Alignment Length:186 Identity:60/186 - (32%)
Similarity:92/186 - (49%) Gaps:31/186 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RKPRWLPVAKSKMFRVPERKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVR--HEETSTADH 95
            ||.|..|.||||:.||.........|...|...:.||:..:|::|.....||.|  ||..:.   
Mouse    27 RKTRHDPPAKSKVGRVQTPPAVDPAEFFVLTERYRQYRETVRALRLEFTLEVRRKLHEARAG--- 88

  Fly    96 IVLTPEQEEAEFQKCLDAN---AAWNAAIAKERDQRLAKKREEKVAYIQERLEAQQLREEE---- 153
             ||.    |.:.|:.:..:   .|||      ||:. .:.:|.::|.:|...:||::::.|    
Mouse    89 -VLA----ERKAQQAITEHRELMAWN------RDEN-RRMQELRIARLQLEAQAQEVQKAEAQAQ 141

  Fly   154 --RKEQA-----NQRVLLEIERSKNYITRENLDAAIETALANPVDHNFAIDMAGNL 202
              ::|||     .|.||...|.:||:||||||:|.||.||.:|..:|:|:...|.:
Mouse   142 RAQEEQAWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDSPKSYNWAVTKEGQV 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS26NP_524134.1 MRP-S26 34..201 CDD:291604 58/182 (32%)
Mrps26NP_997090.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 10/16 (63%)
MRP-S26 28..197 CDD:291604 59/183 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844380
Domainoid 1 1.000 63 1.000 Domainoid score I10217
eggNOG 1 0.900 - - E1_KOG4691
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5346
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108963
Panther 1 1.100 - - LDO PTHR21035
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10616
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.