DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS26 and MRPS26

DIOPT Version :9

Sequence 1:NP_524134.1 Gene:mRpS26 / 40001 FlyBaseID:FBgn0036774 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_110438.1 Gene:MRPS26 / 64949 HGNCID:14045 Length:205 Species:Homo sapiens


Alignment Length:181 Identity:58/181 - (32%)
Similarity:86/181 - (47%) Gaps:25/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RKPRWLPVAKSKMFRVPERKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVR--HEETS--TA 93
            ||.|..|:||||:.||.........|...||..:..|:..:|::|.....||.|  ||..:  .|
Human    27 RKTRHDPLAKSKIERVNMPPAVDPAEFFVLMERYQHYRQTVRALRMEFVSEVQRKVHEARAGVLA 91

  Fly    94 DHIVLTPEQEEAEFQKCLDANAAWNAAIAKE-RDQRLAKKREEKVAYIQERLEAQQLREEERK-- 155
            :...|....|..|..       |||.|..:. .:.|:|:.|:|     :...|.:|..|:.||  
Human    92 ERKALKDAAEHRELM-------AWNQAENRRLHELRIARLRQE-----EREQEQRQALEQARKAE 144

  Fly   156 -----EQANQRVLLEI-ERSKNYITRENLDAAIETALANPVDHNFAIDMAG 200
                 .|..:|.:|:: |..||:||||||:|.:|.||.:..::|:||...|
Human   145 EVQAWAQRKEREVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS26NP_524134.1 MRP-S26 34..201 CDD:291604 57/180 (32%)
MRPS26NP_110438.1 MRP-S26 28..197 CDD:405611 57/180 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154135
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4691
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623955at2759
OrthoFinder 1 1.000 - - FOG0007324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108963
Panther 1 1.100 - - LDO PTHR21035
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10616
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.