DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS26 and mrps26

DIOPT Version :9

Sequence 1:NP_524134.1 Gene:mRpS26 / 40001 FlyBaseID:FBgn0036774 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001002418.1 Gene:mrps26 / 436691 ZFINID:ZDB-GENE-040718-115 Length:207 Species:Danio rerio


Alignment Length:214 Identity:68/214 - (31%)
Similarity:107/214 - (50%) Gaps:26/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRAGCQLLTQSTLPTGKTVG--NSFALEFVRWRRKPRWLPVAKSKMFRVPERKKQSEEERTELM 63
            ||||    |::..||..:.:.  ::..:|.|| .||.|..|.||||:.|:.........|...:.
Zfish     1 MLRA----LSRCPLPAVRLLAPRSAVLVESVR-GRKSRTDPQAKSKIGRIKTPPPVDPVEMITMK 60

  Fly    64 RLHNQYKTQLRSVRQFLREEVVRHEETSTADHIVLTPEQEEAEFQKCLDANAAWNAA-------I 121
            ..:.:|...|:::|...||.::|.........:.....:.:||..|.|   .|||.|       |
Zfish    61 ERYTEYNLILKALRLEFRENMLRKRYEEEVGSVAEERAKRDAEEHKSL---MAWNDAENHRLQVI 122

  Fly   122 AKERDQRLAKKREEKVAYIQERLEAQQLREEERKE--QANQRVLLEI-ERSKNYITRENLDAAIE 183
            .::|.|:.|:..|||      |.||..|.::|.:.  :..:|.:|:: |.:||:||.:|||..||
Zfish   123 REQRVQKEAEAAEEK------RKEAAMLHQQELENYIKEKERQILQLQEEAKNFITLDNLDQRIE 181

  Fly   184 TALANPVDHNFAIDMAGNL 202
            .||.||:::|||||..|.:
Zfish   182 EALDNPINYNFAIDKQGRV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS26NP_524134.1 MRP-S26 34..201 CDD:291604 56/176 (32%)
mrps26NP_001002418.1 MRP-S26 31..200 CDD:291604 57/177 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589290
Domainoid 1 1.000 77 1.000 Domainoid score I8842
eggNOG 1 0.900 - - E1_KOG4691
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5209
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623955at2759
OrthoFinder 1 1.000 - - FOG0007324
OrthoInspector 1 1.000 - - oto38887
orthoMCL 1 0.900 - - OOG6_108963
Panther 1 1.100 - - LDO PTHR21035
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10616
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.