DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS26 and Mrps26

DIOPT Version :9

Sequence 1:NP_524134.1 Gene:mRpS26 / 40001 FlyBaseID:FBgn0036774 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001013224.1 Gene:Mrps26 / 362216 RGDID:1308733 Length:200 Species:Rattus norvegicus


Alignment Length:188 Identity:63/188 - (33%)
Similarity:96/188 - (51%) Gaps:35/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RKPRWLPVAKSKMFRVPERKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVR-----HEETST 92
            ||.|..|.||||:.||   |.....:..||..|..:|:....:||...||..:.     ||..: 
  Rat    27 RKTRHDPPAKSKVGRV---KMPPAVDPAELFVLTERYRQYRETVRALRREFTLEVRGKLHEARA- 87

  Fly    93 ADHIVLTPEQEEA--EFQKCLDANAAWNAAIAKERDQRLAKKREEKVAYIQERLEAQQLREEE-- 153
              .::...:.:||  |.|:.:    |||    :|.::||   :|.::|.:|...:||:||:.|  
  Rat    88 --GVLAERKAQEAIREHQELM----AWN----REENRRL---QELRIARLQLEAQAQELRQAEVQ 139

  Fly   154 ----RKEQA-----NQRVLLEIERSKNYITRENLDAAIETALANPVDHNFAIDMAGNL 202
                ::|||     .|.||...|.:||:||||||:|.||.||.:|..:|:|:...|.:
  Rat   140 AQRAQEEQAWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDSPKSYNWAVTKEGQV 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS26NP_524134.1 MRP-S26 34..201 CDD:291604 61/184 (33%)
Mrps26NP_001013224.1 MRP-S26 28..197 CDD:291604 62/185 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347750
Domainoid 1 1.000 67 1.000 Domainoid score I9615
eggNOG 1 0.900 - - E1_KOG4691
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5232
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623955at2759
OrthoFinder 1 1.000 - - FOG0007324
OrthoInspector 1 1.000 - - oto96569
orthoMCL 1 0.900 - - OOG6_108963
Panther 1 1.100 - - LDO PTHR21035
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.