powered by:
Protein Alignment mRpS26 and gnrh2
DIOPT Version :9
Sequence 1: | NP_524134.1 |
Gene: | mRpS26 / 40001 |
FlyBaseID: | FBgn0036774 |
Length: | 225 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_852104.3 |
Gene: | gnrh2 / 353222 |
ZFINID: | ZDB-GENE-030516-1 |
Length: | 86 |
Species: | Danio rerio |
Alignment Length: | 56 |
Identity: | 14/56 - (25%) |
Similarity: | 21/56 - (37%) |
Gaps: | 9/56 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 WLPVAKSKM-----FRVPERKKQSEEERTELMRL--HNQYKTQLRS--VRQFLREE 83
|.|..|.:: ..|.|..|..|..:...:|. .|..||.|.. :|.|.:.:
Zfish 31 WYPGGKREIDLYDTSEVSEEVKLCEAGKCSYLRPQGRNILKTILLDALIRDFQKRK 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4691 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.