DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS26 and GNRH2

DIOPT Version :10

Sequence 1:NP_524134.1 Gene:mRpS26 / 40001 FlyBaseID:FBgn0036774 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001492.1 Gene:GNRH2 / 2797 HGNCID:4420 Length:120 Species:Homo sapiens


Alignment Length:37 Identity:12/37 - (32%)
Similarity:18/37 - (48%) Gaps:7/37 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 AIETALANPVD--HNFAIDMAGNL-----YHGRSTSQ 210
            |::||..:||.  |....|....|     :.||:|:|
Human    54 ALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTTAQ 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS26NP_524134.1 MRP-S26 34..201 CDD:464391 7/21 (33%)
GNRH2NP_001492.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..81 8/26 (31%)

Return to query results.
Submit another query.