DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS26 and mrps-26

DIOPT Version :9

Sequence 1:NP_524134.1 Gene:mRpS26 / 40001 FlyBaseID:FBgn0036774 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001379768.1 Gene:mrps-26 / 175718 WormBaseID:WBGene00016412 Length:255 Species:Caenorhabditis elegans


Alignment Length:183 Identity:54/183 - (29%)
Similarity:81/183 - (44%) Gaps:2/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KPRWLPVAKSKMFRVPERKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVRHEETSTADHIVL 98
            ||..||.:|..::.|.....|..|:..||:...:.|...:.|:|:..|.|:.  :..|....|..
 Worm    45 KPPILPPSKKVLYHVVHAPWQKPEDVEELLWRRHAYNNAVISLREVFRAELA--QNASHGQGIEA 107

  Fly    99 TPEQEEAEFQKCLDANAAWNAAIAKERDQRLAKKREEKVAYIQERLEAQQLREEERKEQANQRVL 163
            ..|.|..|..:.:..|...|......|.:|.|:..:|..:.|.|.:..:..:....|:||...|.
 Worm   108 MKEAEALELDELIAQNEKRNEEKRAARKEREAEDAKETKSVILEEIRVELEKRNAGKKQAEDEVK 172

  Fly   164 LEIERSKNYITRENLDAAIETALANPVDHNFAIDMAGNLYHGRSTSQLPDATP 216
            ..|.||..:|||.||:..|..||..|..::||||.|||.|......:..:.||
 Worm   173 NAISRSSEFITRSNLETKILEALEKPTIYDFAIDRAGNKYFVPEPVKYQEGTP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS26NP_524134.1 MRP-S26 34..201 CDD:291604 49/166 (30%)
mrps-26NP_001379768.1 MRP-S26 45..211 CDD:405611 50/167 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163369
Domainoid 1 1.000 74 1.000 Domainoid score I5996
eggNOG 1 0.900 - - E1_KOG4691
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I3836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28871
OrthoDB 1 1.010 - - D1623955at2759
OrthoFinder 1 1.000 - - FOG0007324
OrthoInspector 1 1.000 - - oto20840
orthoMCL 1 0.900 - - OOG6_108963
Panther 1 1.100 - - LDO PTHR21035
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10616
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.