DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS26 and mrps26

DIOPT Version :9

Sequence 1:NP_524134.1 Gene:mRpS26 / 40001 FlyBaseID:FBgn0036774 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001096289.1 Gene:mrps26 / 100124861 XenbaseID:XB-GENE-6454877 Length:203 Species:Xenopus tropicalis


Alignment Length:178 Identity:52/178 - (29%)
Similarity:84/178 - (47%) Gaps:15/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RKPRWLPVAKSKMFRVPERKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVRHEETSTADHIV 97
            ||.|..|.||||:.|:.........|...:...:.:|...|.::|...:|.|::.:.......:.
 Frog    25 RKSRTDPPAKSKVSRIKYPPPVCVRELLNVGMRYREYSAILTAIRAECKEGVLQSQYEEQVGSLA 89

  Fly    98 LTPEQEEAEFQKCLDANAAWNAAIAKERDQRLAKKREEKVAYIQERLEAQQLREEERKEQANQRV 162
            ....:.|:|..|.|   ..||    .|:::...:|||::....||.|:.|:....|:...|.|::
 Frog    90 EQRHRLESEEHKAL---MVWN----DEQNRAALRKREQRQRLEQEVLQRQRYLSVEQNMMAEQQL 147

  Fly   163 LLEIER--------SKNYITRENLDAAIETALANPVDHNFAIDMAGNL 202
            :.|.||        ||::||.|||...||.||.||:.:||.:|..|.:
 Frog   148 IREKEREIEMLQEMSKSFITAENLLERIEAALDNPISYNFCLDKEGRV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS26NP_524134.1 MRP-S26 34..201 CDD:291604 50/174 (29%)
mrps26NP_001096289.1 MRP-S26 26..195 CDD:373410 51/175 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9746
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5155
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007324
OrthoInspector 1 1.000 - - oto103272
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.