DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARL1 and Arf102F

DIOPT Version :9

Sequence 1:NP_001168.1 Gene:ARL1 / 400 HGNCID:692 Length:181 Species:Homo sapiens
Sequence 2:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster


Alignment Length:180 Identity:104/180 - (57%)
Similarity:136/180 - (75%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQV 65
            ||...||:.:.|||.::||||::|||.||||||||:|::||:||||||||||||||.|||:.|.|
  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65

Human    66 WDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDM 130
            ||:|||..|||.||.|:.||..:|:||||.|||||..::.||..||:|:|||.|:|:|||||||:
  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDL 130

Human   131 EQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR 180
            ..|||::|:.:.|.|..|::|.|.|..|.||:|.||.|.::||...|..:
  Fly   131 PNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARL1NP_001168.1 Arl1 19..176 CDD:206718 95/156 (61%)
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 104/178 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.