DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and NR1I3

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:XP_005245750.1 Gene:NR1I3 / 9970 HGNCID:7969 Length:429 Species:Homo sapiens


Alignment Length:528 Identity:113/528 - (21%)
Similarity:185/528 - (35%) Gaps:159/528 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 HQAQQH-------QQQHQQHQQHQQH----VIASVSSSSSSSAIGSGGSSSSHIFRTP------- 375
            |:...|       ..||..|.....|    ..:.|.:.:..|...:||    ||.:|.       
Human     3 HKVPTHWSPSPCATNQHFCHAGKTSHPGLCPESRVCALTPQSLRATGG----HIKQTSLVFQILR 63

  Fly   376 -VVSSSSSSNMHHQQQQQQQQSSLGN----SVMRPPPPPPPPKVKHASSSSSGNSSSSNTNNSSS 435
             ::.:|:...:...::.|||:.|||.    .::.|.....|.:.:...|.|.|            
Human    64 VIIPNSNHWQLLRSEENQQQRGSLGRGIPYQILWPAGDMLPKRSRRTVSKSIG------------ 116

  Fly   436 SSNGEEPSSSIPDLEFDGTTVLCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQ 500
                       |...|.|:                                              
Human   117 -----------PTCPFAGS---------------------------------------------- 124

  Fly   501 CSILRINRNRCQYCRLKKCIAVGMSRDAVRFGRVPKREKARILAAMQ-QSTQNRGQQRALATELD 564
            |.:.:..|..|..|||:||:..||.:|.:.        .|..||..: :..|.|.||..:... .
Human   125 CEVSKTQRRHCPACRLQKCLDAGMRKDMIL--------SAEALALRRAKQAQRRAQQTPVQLS-K 180

  Fly   565 DQPRLLAAVLRAHLETCEFTKEKVSAMRQRARDCP-------SYSMPTLLACPLNPAPELQSEQE 622
            :|..|:..:|.||      |:...:...|..:..|       ...:|||       ||.|.....
Human   181 EQEELIRTLLGAH------TRHMGTMFEQFVQFRPPAHLFIHHQPLPTL-------APVLPLVTH 232

  Fly   623 FSQRFAHVIRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVM 687
            |:.....::..||.|...:|.|:.|..:|:.:|||....:      ||..  .:|:..||..|..
Human   233 FADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVE------ICHI--VLNTTFCLQTQNF 289

  Fly   688 ----RRDAIQNGA--------NARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITP-----DR 735
                .|..|::||        ...|| :..|:|...:..:.|.:.|..|..|:.|.:|     ||
Human   290 LCGPLRYTIEDGARVSPTVGFQVEFL-ELLFHFHGTLRKLQLQEPEYVLLAAMALFSPAPYLTDR 353

  Fly   736 PGLRNLELIEKMYSRLKGCLQ-YIVAQNRPDQPEFL-AKLLETMPDLRTLSTLHTEKLVVFRTEH 798
            ||:...:.|:::...:...|| ||..|.|..:..|| ||||..:.:||:::..:.     ::.:|
Human   354 PGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYG-----YQIQH 413

  Fly   799 KELLRQQM 806
            .:.|...|
Human   414 IQGLSAMM 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 12/87 (14%)
NR_LBD_REV_ERB 609..796 CDD:132738 53/205 (26%)
NR1I3XP_005245750.1 NR_DBD_like <108..154 CDD:295381 17/114 (15%)
NR_LBD_PXR_like 178..427 CDD:132732 67/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.