DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and NR1I2

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:NP_071285.1 Gene:NR1I2 / 8856 HGNCID:7968 Length:473 Species:Homo sapiens


Alignment Length:467 Identity:115/467 - (24%)
Similarity:201/467 - (43%) Gaps:70/467 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 HHQQQQQQQQSSLGNSVMRPPPPPPPPKVKHASSSSSGNSSSSNTNNSSSSSNGE----EPSSSI 446
            ||.::         .|:..|..|......:.||:...|..::.......|.::.:    |.:.|:
Human     7 HHFKE---------GSLRAPAIPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTESV 62

  Fly   447 P-------DLEFDGTTVLCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSIL 504
            |       |.|..|..: ||||||||:|:|:.|.:||||||||||::::..:.|...:...|.|.
Human    63 PGKPSVNADEEVGGPQI-CRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEIT 126

  Fly   505 RINRNRCQYCRLKKCIAVGMSRDAVRFGRVPKREKARILAAMQQ--STQNRG------QQRALAT 561
            |..|.:||.|||:||:..||.::.:......:..:|.|.....:  .||..|      :||.:..
Human   127 RKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIR 191

  Fly   562 ELDDQPRLLAAVLRAHLET----------CEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPE 616
            ||.|..........:|.:.          ||..:...:..|:.|   ..:|......|.|..:.:
Human   192 ELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEA---AKWSQVRKDLCSLKVSLQ 253

  Fly   617 LQSEQ----------------------EFSQRFAHVIRGVIDFAGMIPGFQLLTQDDKFTLLKAG 659
            |:.|.                      ..:....::.:|:|.||.:|..|:.|..:|:.:|||..
Human   254 LRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGA 318

  Fly   660 LFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGL 724
            .|:...:|...:|::...:..|........|..  |...:.|::....|...:..:.|.:.|..|
Human   319 AFELCQLRFNTVFNAETGTWECGRLSYCLEDTA--GGFQQLLLEPMLKFHYMLKKLQLHEEEYVL 381

  Fly   725 FCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNRPDQP--EFL-AKLLETMPDLRTLSTL 786
            ..||.|.:|||||:....:::::..:....|:..:..||| ||  .|| .|::..:.:||:::..
Human   382 MQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRP-QPAHRFLFLKIMAMLTELRSINAQ 445

  Fly   787 HTEKLVVFRTEH 798
            ||::|:..:..|
Human   446 HTQRLLRIQDIH 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 36/87 (41%)
NR_LBD_REV_ERB 609..796 CDD:132738 48/211 (23%)
NR1I2NP_071285.1 NR_DBD_PXR 79..166 CDD:143536 37/87 (43%)
NR_LBD_PXR_like 182..467 CDD:132732 60/282 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.