DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and Nr1i2

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:NP_443212.1 Gene:Nr1i2 / 84385 RGDID:69057 Length:431 Species:Rattus norvegicus


Alignment Length:424 Identity:118/424 - (27%)
Similarity:197/424 - (46%) Gaps:66/424 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 EEPSSSIPDLEFDGTTVLCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSIL 504
            |||   |...|.||...:||||||||:|:|:.|.:||||||||||::::.::.|...:...|.|.
  Rat    23 EEP---INVDEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEIT 84

  Fly   505 RINRNRCQYCRLKKCIAVGMSRDAV--------RFGRVPKREKARILAAMQQSTQNRGQQRALAT 561
            |..|.:||.|||:||:..||.::.:        |...:.::::.:|.|..........:|:||..
  Rat    85 RKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQ 149

  Fly   562 ELDDQPRLLAAVLRAHLETCEFTKEKVSAMRQRA---RDC--PSYSMPTLL------------AC 609
            ||.|          |.::|.:.|.......|..|   .||  |.....:||            :.
  Rat   150 ELMD----------AQMQTFDTTFSHFKDFRLPAVFHSDCELPEVLQASLLEDPATWSQIMKDSV 204

  Fly   610 PLNPAPELQSE---------------QEFSQRFAH-------VIRGVIDFAGMIPGFQLLTQDDK 652
            |:..:.:|:.|               :|......|       :.:|||:||.:|..|:.|..:|:
  Rat   205 PMKISVQLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISHFRELPIEDQ 269

  Fly   653 FTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNL 717
            .:|||...|:...:|...|||:...:..|  |::.......||...:.|:|....|...:..:.|
  Rat   270 ISLLKGATFEMCILRFNTMFDTETGTWEC--GRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQL 332

  Fly   718 TDAEIGLFCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNRP-DQPEFL-AKLLETMPDL 780
            .:.|..|..||.|.:|||||:....:::::..|....|:..:..:|| ....|| .|::..:.:|
  Rat   333 REEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTEL 397

  Fly   781 RTLSTLHTEKLVVFRTEH--KELLRQQMWSMEDG 812
            |:::...|::|:..:..|  ...|.|:::|..||
  Rat   398 RSINAQQTQQLLRIQDTHPFATPLMQELFSSTDG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 37/95 (39%)
NR_LBD_REV_ERB 609..796 CDD:132738 51/210 (24%)
Nr1i2NP_443212.1 NR_DBD_like 37..124 CDD:413390 36/86 (42%)
Bipartite nuclear localization signal. /evidence=ECO:0000250 63..89 6/25 (24%)
Hinge 105..142 3/36 (8%)
NR_LBD 140..425 CDD:416257 70/296 (24%)
Hyperforin binding, agonist. /evidence=ECO:0000250|UniProtKB:O75469 282..285 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.