DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and RARG

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:XP_024304880.1 Gene:RARG / 5916 HGNCID:9866 Length:541 Species:Homo sapiens


Alignment Length:461 Identity:136/461 - (29%)
Similarity:207/461 - (44%) Gaps:82/461 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 QQQQSSLGNSVMRPPPPPPPPKVKHASSSSSGNSSSSNTNNSSSSSNGEEPSSSIPDLEFDGTTV 456
            :.|.:|....|...|.|||||:|                         .:|              
Human   151 ETQSTSSEEMVPSSPSPPPPPRV-------------------------YKP-------------- 176

  Fly   457 LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIA 521
             |.||.||:||:||||.||||||||||||||:.:.| .|.:::.|.|.::.|||||||||:||..
Human   177 -CFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVY-TCHRDKNCIINKVTRNRCQYCRLQKCFE 239

  Fly   522 VGMSRDAVRFGRVPKREKARILAAMQQSTQNRGQQRALATELDDQPRLLAAVLRAHLET----CE 582
            ||||::|||..|..|:::.:        .:.......|:.:|::   |:..|.:||.||    |:
Human   240 VGMSKEAVRNDRNKKKKEVK--------EEGSPDSYELSPQLEE---LITKVSKAHQETFPSLCQ 293

  Fly   583 FTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRFAHVIRGVIDFAGMIPGFQLL 647
            ..|...::........                 :|....:||:.....|..:::||..:|||..|
Human   294 LGKYTTNSSADHRVQL-----------------DLGLWDKFSELATKCIIKIVEFAKRLPGFTGL 341

  Fly   648 TQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF--LVDSTFNFAE 710
            :..|:.|||||...|.|.:|:...:....:::...:|..:.|..:.   ||.|  |.|..|.||.
Human   342 SIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH---NAGFGPLTDLVFAFAG 403

  Fly   711 RMNSMNLTDAEIGLFCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLE 775
            ::..:.:.|.|.||..||.||..||..|...|.::|:...|...|:....:.||.||....::|.
Human   404 QLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLM 468

  Fly   776 TMPDLRTLSTLHTEKLVVFRTE----HKELLRQQMWSMEDGNNSDGQQNKSPSGSWADAMDVEAA 836
            .:.|||.:||...|:.:..:.|    ...|:|:.:.:.|...:...|....|:.|..|.:.....
Human   469 KITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQG 533

  Fly   837 KSPLGS 842
            |..|.|
Human   534 KGGLKS 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 49/87 (56%)
NR_LBD_REV_ERB 609..796 CDD:132738 55/188 (29%)
RARGXP_024304880.1 NR_DBD_RAR 172..252 CDD:143522 49/120 (41%)
NR_LBD_RAR 275..505 CDD:132735 66/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.