DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and nr1i2

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:NP_001092087.2 Gene:nr1i2 / 565875 ZFINID:ZDB-GENE-030903-3 Length:430 Species:Danio rerio


Alignment Length:419 Identity:104/419 - (24%)
Similarity:190/419 - (45%) Gaps:57/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 SNTNNSSSSSNGEEPSSSIPDLEFDGTTVLCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQY 492
            |..::|......||      :.|.|....:|:|||||::|:|:...:||||||||||::::..|.
Zfish    22 SPLDDSGHGDGSEE------ETEEDDEPKICQVCGDKSTGYHFNAMTCEGCKGFFRRAMKRPAQL 80

  Fly   493 RPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAVRFGRVPKREKARILAAMQQSTQNRGQQR 557
             .|.....|.|.:.||.:||.|||:||:::||.|:.:......::.:.:|        :.:..|.
Zfish    81 -CCPFQSACVITKSNRRQCQSCRLQKCLSIGMKRELIMSDEAVEKRRLQI--------RRKRMQE 136

  Fly   558 ALATELDDQPRLLAAVLRAHLETCEFTKEKVSAMR--QRARDCPSYSMP---------------- 604
            ...|....|..::..:|.||.:|.:.|....|..|  .|.:...|.|:|                
Zfish   137 EPVTLTPQQEAVIQELLNAHKKTFDMTCAHFSQFRPLDRGQKSVSESIPVTNGSWIDHRPIAEDP 201

  Fly   605 -------TLLACPLNPAPELQSEQE------------FSQRFAHVIRGVIDFAGMIPGFQLLTQD 650
                   |.|:...:....|..|::            |:....::|:.||:|...:..|:.|..:
Zfish   202 VQWVFNSTSLSSSSSSCQSLDKEKKHFKSGSFTSLPHFTDLTTYMIKNVINFGKTLTMFRALVME 266

  Fly   651 DKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSM 715
            |:.:|||...|:.:.:.....|:.......|...|....||.:.|.. ..|:|...||...:..:
Zfish   267 DQISLLKGATFEIILIHFNMFFNEVTGIWECGPLQYCMDDAFRAGFQ-HHLLDPMMNFHYTLRKL 330

  Fly   716 NLTDAEIGLFCAIVLITPDRPGLRNLELIEKMYSRLKGCLQ-YIVA-QNRPDQPEFLAKLLETMP 778
            .|.:.|..|..|:.|.:|||||:.:.::|::....|...|: ||.| :|.|::.....|::..:.
Zfish   331 RLHEEEYVLMQALSLFSPDRPGVTDHKVIDRNQETLALTLKTYIEAKRNGPEKNLLFPKIMGCLT 395

  Fly   779 DLRTLSTLHTEKLVVFRTEHKELLRQQMW 807
            ::|:::..:|::::..:....|:  ..:|
Zfish   396 EMRSMNEEYTKQVLKIQDMQPEV--SPLW 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 34/87 (39%)
NR_LBD_REV_ERB 609..796 CDD:132738 45/200 (23%)
nr1i2NP_001092087.2 NR_DBD_PXR 45..131 CDD:143536 35/94 (37%)
NR_LBD_PXR_like 141..425 CDD:132732 61/285 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.