DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and vdrb

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:NP_001153457.1 Gene:vdrb / 564511 ZFINID:ZDB-GENE-080403-10 Length:422 Species:Danio rerio


Alignment Length:405 Identity:115/405 - (28%)
Similarity:193/405 - (47%) Gaps:56/405 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 SSSIPDLEFD-GTTVLCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRI 506
            |:.:|| ||| ....:|.||||||:|||:...:|||||||||||:::|..: .|..|..|:|.:.
Zfish     8 STQVPD-EFDRNVPRICGVCGDKATGFHFNAMTCEGCKGFFRRSMKRKASF-TCPFNGSCTITKD 70

  Fly   507 NRNRCQYCRLKKCIAVGMSRDAVRFGRVPKREKARILAAMQQSTQNRGQQRALATELDDQPRLLA 571
            ||..||.||||:|:.:||.::.:......:|:|..|.....:......|:..|:   |:|..::.
Zfish    71 NRRHCQACRLKRCLDIGMMKEFILTDEEVQRKKELIQRRKDEEAHREAQKPRLS---DEQRNIID 132

  Fly   572 AVLRAHLETCEFTKEKVSAMRQRARDCP--------------------SYS-----------MPT 605
            .::.||.:|.:.:....|..|...|:.|                    |:|           :..
Zfish   133 TLVDAHHKTYDDSYSDFSRFRPPVREGPVTRSASRAASLHSLSDASSDSFSHSPESGDRKMNLSN 197

  Fly   606 LLAC----PLNPAPELQSEQ--------EFSQRFAHVIRGVIDFAGMIPGFQLLTQDDKFTLLKA 658
            ||..    .|:.:|:.:.|.        ..:...::.|:.||.||.|||||:.||.:|:..|||:
Zfish   198 LLMMYQEQGLSSSPDSKEEDGSSLSMLPHLADLVSYSIQKVIGFAKMIPGFRELTAEDQIALLKS 262

  Fly   659 GLFDALFVRLICMFDSSINSIICLNGQVMR---RDAIQNGANARFLVDSTFNFAERMNSMNLTDA 720
            ...:.:.:|....|.....|..| .|...:   .|..:.|.... |::....|...:..:||.:.
Zfish   263 SAIEVIMLRSNQSFSLEDMSWSC-GGPEFKYCVNDVTKAGHTLE-LLEPLVKFQVGLKKLNLHEE 325

  Fly   721 EIGLFCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLST 785
            |..|..||.|::|||||:::...:|.:..::...||..:..:.|......||:::.:.|||:|:.
Zfish   326 EHVLLMAICLLSPDRPGVQDHVRVEALQDKVSEVLQAYIRAHHPGGRLLYAKMIQKLADLRSLNE 390

  Fly   786 LHTE--KLVVFRTEH 798
            .|::  :.:.|:.||
Zfish   391 EHSKQYRSLSFQPEH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 39/87 (45%)
NR_LBD_REV_ERB 609..796 CDD:132738 52/203 (26%)
vdrbNP_001153457.1 NR_DBD_VDR 15..121 CDD:143513 43/106 (41%)
Hinge 96..125 5/31 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..128 4/24 (17%)
NR_LBD 123..421 CDD:299703 68/288 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..190 6/44 (14%)
Vitamin D3 binding. /evidence=ECO:0000250 224..234 0/9 (0%)
Interaction with coactivator LXXLL motif. /evidence=ECO:0000250 243..261 9/17 (53%)
Vitamin D3 binding. /evidence=ECO:0000250 268..275 1/6 (17%)
9aaTAD. /evidence=ECO:0000250|UniProtKB:P11473 411..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.