DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and PPARD

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:NP_001165289.1 Gene:PPARD / 5467 HGNCID:9235 Length:441 Species:Homo sapiens


Alignment Length:405 Identity:139/405 - (34%)
Similarity:210/405 - (51%) Gaps:65/405 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 SSSNTNNSSSSSNGEEPSSSIPDLEF--DGTT-----VLCRVCGDKASGFHYGVHSCEGCKGFFR 483
            |||.|:.|.|||    |.|.:..|:.  ||.:     :.||||||||||||||||:|||||||||
Human    39 SSSYTDLSRSSS----PPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFR 99

  Fly   484 RSIQQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAVRFGRVPKREKARILAAMQQ 548
            |:|:.|::|..|.::  |.|.:.|||:|||||.:||:|:|||.:|:||||:|:.||.:::|.:  
Human   100 RTIRMKLEYEKCERS--CKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGL-- 160

  Fly   549 STQNRGQQRALATELDDQPRLLAAVLRAHLETCEFTKEKV-SAMRQRARDCPSYSMP-------T 605
             |.|.|.|  ...::.|.......:..|:|:....||:|. |.:..:|    |::.|       |
Human   161 -TANEGSQ--YNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKA----SHTAPFVIHDIET 218

  Fly   606 L-----------LACPLNPAPELQSEQEFSQRFAHV-----------IRGVIDFAGMIPGFQLLT 648
            |           |...|.|..|:.         .||           :|.:.:||..||.|..|.
Human   219 LWQAEKGLVWKQLVNGLPPYKEIS---------VHVFYRCQCTTVETVRELTEFAKSIPSFSSLF 274

  Fly   649 QDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF--LVDSTFNFAER 711
            .:|:.||||.|:.:|:|..|..:.:.  :.::..||...............|  :::..|.||.:
Human   275 LNDQVTLLKYGVHEAIFAMLASIVNK--DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVK 337

  Fly   712 MNSMNLTDAEIGLFCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLET 776
            .|::.|.|:::.||.|.:::..|||||.|:..:|.:...:...|::.:..|.||......|||:.
Human   338 FNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQK 402

  Fly   777 MPDLRTLSTLHTEKL 791
            |.|||.|.|.|.:.:
Human   403 MADLRQLVTEHAQMM 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 55/92 (60%)
NR_LBD_REV_ERB 609..796 CDD:132738 54/196 (28%)
PPARDNP_001165289.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 9/18 (50%)
NR_DBD_Ppar 73..156 CDD:143523 54/84 (64%)
NR_LBD_PPAR 173..440 CDD:132730 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6008
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40886
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.