DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and PPARA

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:NP_001001928.1 Gene:PPARA / 5465 HGNCID:9232 Length:468 Species:Homo sapiens


Alignment Length:410 Identity:141/410 - (34%)
Similarity:213/410 - (51%) Gaps:64/410 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 SSGNSSSSNTNNSSSSSNGEEPSSSIPDLEFDGTTVLCRVCGDKASGFHYGVHSCEGCKGFFRRS 485
            |..:|.||.|......|..|.||.::        .:.||:|||||||:|||||:||||||||||:
Human    73 SPASSPSSVTYPVVPGSVDESPSGAL--------NIECRICGDKASGYHYGVHACEGCKGFFRRT 129

  Fly   486 IQQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAVRFGRVPKREKARILAAM---Q 547
            |:.|:.|..|  ::.|.|.:.|||:|||||..||::||||.:|:||||:|:.|||::.|.:   :
Human   130 IRLKLVYDKC--DRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCE 192

  Fly   548 QSTQNRGQQRALATELDDQPRLLAAVLRAHLETCEFTKEKVSA---MRQRARDCPSY---SMPTL 606
            ...::        :|..|...|...:..|:|:  .|...||.|   :..:|.:.|.:   .|.||
Human   193 HDIED--------SETADLKSLAKRIYEAYLK--NFNMNKVKARVILSGKASNNPPFVIHDMETL 247

  Fly   607 LACPLNPAPELQS----EQEFSQRFAH--------VIRGVIDFAGMIPGFQLLTQDDKFTLLKAG 659
            .........:|.:    .:|...|..|        .:..:.:||..||||..|..:|:.||||.|
Human   248 CMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYG 312

  Fly   660 LFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANAR-FL----------VDSTFNFAERMN 713
            :::|:|..|        :|::..:|.::   |..||...| ||          ::..|:||.:.|
Human   313 VYEAIFAML--------SSVMNKDGMLV---AYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFN 366

  Fly   714 SMNLTDAEIGLFCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMP 778
            ::.|.|::|.||.|.::...|||||.|:..||||...:...|:..:..|.||......|||:.|.
Human   367 ALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMA 431

  Fly   779 DLRTLSTLHTEKL-VVFRTE 797
            |||.|.|.|.:.: ::.:||
Human   432 DLRQLVTEHAQLVQIIKKTE 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 52/87 (60%)
NR_LBD_REV_ERB 609..796 CDD:132738 62/210 (30%)
PPARANP_001001928.1 NR_DBD_Ppar 101..184 CDD:143523 53/84 (63%)
NR_LBD_PPAR 201..467 CDD:132730 77/264 (29%)
Required for heterodimerization with RXRA 304..433 45/139 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40886
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4550
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.