DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and Ppara

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:XP_006242213.1 Gene:Ppara / 25747 RGDID:3369 Length:605 Species:Rattus norvegicus


Alignment Length:398 Identity:134/398 - (33%)
Similarity:211/398 - (53%) Gaps:40/398 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 SSGNSSSSNTNNSSSSSNGEEPSSSIPDLEFDGTTVLCRVCGDKASGFHYGVHSCEGCKGFFRRS 485
            |..:|.||.:..:..:|..|.|.:::        .:.||:|||||||:|||||:||||||||||:
  Rat   210 SPASSPSSVSCPAVPTSTDESPGNAL--------NIECRICGDKASGYHYGVHACEGCKGFFRRT 266

  Fly   486 IQQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAVRFGRVPKREKARILAAMQQST 550
            |:.|:.|..|  ::.|.|.:.|||:|||||..||::||||.:|:||||:|:.|||::.|.:....
  Rat   267 IRLKLAYDKC--DRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCE 329

  Fly   551 QNRGQQRALATELDDQPRLLAAVLRAHLETCEFTKEKVSA---MRQRARDCPSY---SMPTLLAC 609
            .:...     :|..|...|...:..|:|:  .|...||.|   :..:..:.|.:   .|.||...
  Rat   330 HDLKD-----SETADLKSLAKRIHEAYLK--NFNMNKVKARVILAGKTSNNPPFVIHDMETLCMA 387

  Fly   610 PLNPAPELQS----EQEFSQRFAH--------VIRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFD 662
            ......::.:    .:|...||.|        .:..:.:||..||||..|..:|:.||||.|:::
  Rat   388 EKTLVAKMVANGVENKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYE 452

  Fly   663 ALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF--LVDSTFNFAERMNSMNLTDAEIGLF 725
            |:|..|..:.:.. ..:|......:.|:.::| ....|  :::..|:||.:.|::.|.|::|.||
  Rat   453 AIFTMLSSLMNKD-GMLIAYGNGFITREFLKN-LRKPFCDIMEPKFDFAMKFNALELDDSDISLF 515

  Fly   726 CAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEK 790
            .|.::...|||||.|:..|||:...:...|:..:..|.||......|||:.|.|||.|.|.|.:.
  Rat   516 VAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDTFLFPKLLQKMVDLRQLVTEHAQL 580

  Fly   791 L-VVFRTE 797
            : |:.:||
  Rat   581 VQVIKKTE 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 52/87 (60%)
NR_LBD_REV_ERB 609..796 CDD:132738 58/201 (29%)
PparaXP_006242213.1 NR_DBD_Ppar 238..321 CDD:143523 53/84 (63%)
NR_LBD_PPAR 338..604 CDD:132730 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45025
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.