DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip75B and nhr-206

DIOPT Version :9

Sequence 1:NP_001246821.1 Gene:Eip75B / 39999 FlyBaseID:FBgn0000568 Length:1412 Species:Drosophila melanogaster
Sequence 2:NP_506033.1 Gene:nhr-206 / 187660 WormBaseID:WBGene00011097 Length:410 Species:Caenorhabditis elegans


Alignment Length:456 Identity:101/456 - (22%)
Similarity:164/456 - (35%) Gaps:135/456 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 PPPKVKHASSSSSGNSSSSNTNNSSSSSNGEEPSSSIPDLEFDGTTVLCRVCGDKASGFHYGVHS 474
            |..||......|:.||..|...|.:|       .:.:|:        .|.|||:.|.|:||.|.:
 Worm    10 PDIKVDERYCESTSNSQQSEITNETS-------RNVLPE--------KCEVCGNPAVGYHYDVAT 59

  Fly   475 CEGCKGFFRRSIQQKIQYRP--CTKNQQCSILRINRNR--CQYCRLKKCIAVGMSRDAVRF---- 531
            |.|||.||||::   |..|.  |.:.:.|.:....:||  |..||..||..|||:..|:|.    
 Worm    60 CNGCKAFFRRTV---ITGRRVICRRRKNCLVEMEPKNRRICPGCRFSKCEEVGMNPRAIRAEISS 121

  Fly   532 -GRVPKRE-------KARILAAMQQSTQ--------------------------NRGQQRALATE 562
             |::.|.|       :::|:.:.:....                          |.|..|.|:..
 Worm   122 GGKILKDELIAKREPRSKIMLSPKSKENEVSRLISDLNLIENQIDELFNSSLPINYGDWRTLSEI 186

  Fly   563 LDDQPRLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF 627
            :..:|.|                 |||            .:|.|.........||..       :
 Worm   187 IQMKPYL-----------------KVS------------KIPNLKLIRNQMNAELAG-------Y 215

  Fly   628 AHVIRG---VIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLIC-MFDSSINSIICLNGQVMR 688
            ||  .|   ::::|.|:..|..::::....|:|.|||       :| ....|..||...|..::|
 Worm   216 AH--NGSLAMVEYAKMLDFFPKISKETAIKLVKHGLF-------MCGSLSFSRRSIQKYNSDILR 271

  Fly   689 RDAIQNGANA--------------RFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITP---DRP 736
               ..:|:.|              |.:...|.:...|   :.|...|.....||.:..|   |.|
 Worm   272 ---FTDGSVAGKPKTNWNGVMLDHRRIAQKTLHSILR---VKLDYVEYLFLKAITMCNPAVSDFP 330

  Fly   737 GLRNLELIEK-MYSRLKGCLQYIVAQN-RPDQPEFLAKLLETMPDLRTLSTLHTEKLVVFRTEHK 799
            . .:.::|:| .::..:..|.|.:.|: :....:..|.:|..|..:............|||:.:.
 Worm   331 A-EDQKIIDKHRFNYAQSLLNYCLKQHGQIHGADRFASILSIMSIMEVQQKEEKSCFFVFRSIYS 394

  Fly   800 E 800
            |
 Worm   395 E 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip75BNP_001246821.1 NR_DBD_REV_ERB 453..541 CDD:143540 36/103 (35%)
NR_LBD_REV_ERB 609..796 CDD:132738 41/209 (20%)
nhr-206NP_506033.1 ZnF_C4 42..112 CDD:197701 31/72 (43%)
Glyco_hydro_30 <128..229 CDD:304972 19/138 (14%)
HOLI 216..376 CDD:214658 37/175 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.