DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr92 and WDR55

DIOPT Version :9

Sequence 1:NP_649025.1 Gene:Wdr92 / 39997 FlyBaseID:FBgn0036771 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_565782.1 Gene:WDR55 / 817987 AraportID:AT2G34260 Length:353 Species:Arabidopsis thaliana


Alignment Length:302 Identity:69/302 - (22%)
Similarity:107/302 - (35%) Gaps:77/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 MAIGDFEGRLQV--LDMEQPDLPVYNVKAHNGIINTIDAIGGTQIDCGAPEIVTGSRDGAVKVWD 142
            :|.|..:|.|.:  .|.:...:....|:||......:..|...|      .|||.|.|.::...|
plant    21 VAAGLIDGHLHLYRYDSDSSLVRERKVRAHKESCRAVRFIDDGQ------RIVTASADCSILATD 79

  Fly   143 IRQGQAPVVDMSPPPQMGDGVNNSSGRRDCWAVAFGNTYNAEERIVAAGYDNGDLKIFDLRSLSV 207
            :..| |.|..:....:  |.||              ...|..|..:|:|.|.|.:||:|.|..|.
plant    80 VETG-AQVAHLENAHE--DAVN--------------TLINVTETTIASGDDKGCVKIWDTRQRSC 127

  Fly   208 RWEATM-KNGICGLEFDRRDIPMNKLAVTTLEGGLLVFDMRTQHPTKGFSYVEERNAGRSVGTNG 271
            ..|... ::.|.|:.|....:   ||.||:.:|.|.|.::||........:.|:......:..||
plant   128 SHEFNAHEDYISGMTFASDSM---KLVVTSGDGTLSVCNLRTSKVQSQSEFSEDELLSVVIMKNG 189

  Fly   272 --VISGPKATVWVVRHLPQNRDLFLTGGGTGSIRLWQY--EYPDR------------------RV 314
              ||.|                   |..||..:..|.:  :..||                  |:
plant   190 RKVICG-------------------TQNGTLLLYSWGFFKDCSDRFVDLAPNSVDALLKLDEDRL 235

  Fly   315 IDDSDGNKLGVAGAL-NMLSAATLSSQPVHCFDWHPDKLGLA 355
            |...|...:.:.|.| |.:      .||:...|:..:.|.|:
plant   236 ITGCDNGIISLVGILPNRI------IQPIGSHDYPIEDLALS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr92NP_649025.1 WD40 <2..354 CDD:225201 68/299 (23%)
WD40 77..366 CDD:295369 69/302 (23%)
WD40 repeat 111..165 CDD:293791 13/53 (25%)
WD40 repeat 173..210 CDD:293791 11/36 (31%)
WD40 repeat 217..256 CDD:293791 12/38 (32%)
WD40 repeat 280..333 CDD:293791 12/73 (16%)
WD40 repeat 342..366 CDD:293791 3/14 (21%)
WDR55NP_565782.1 WD40 12..290 CDD:392136 69/302 (23%)
WD40 repeat 12..49 CDD:293791 6/27 (22%)
WD40 repeat 54..90 CDD:293791 11/42 (26%)
WD40 repeat 98..132 CDD:293791 13/47 (28%)
WD40 repeat 138..176 CDD:293791 12/40 (30%)
WD40 repeat 224..246 CDD:293791 3/21 (14%)
WD40 repeat 265..289 CDD:293791 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.