DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr92 and Bub3

DIOPT Version :9

Sequence 1:NP_649025.1 Gene:Wdr92 / 39997 FlyBaseID:FBgn0036771 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001287587.1 Gene:Bub3 / 43490 FlyBaseID:FBgn0025457 Length:326 Species:Drosophila melanogaster


Alignment Length:339 Identity:70/339 - (20%)
Similarity:130/339 - (38%) Gaps:108/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VILGSKANGH-------GIMDIYELNQDKLVKVKSVEKKVAFKCGTFGAASLRNRHMAIGDFEGR 88
            |..|.|:|.:       |.:..|::..::| :.|.|:......|     |.:...|:..|..:.:
  Fly    19 VKFGPKSNQYMAASSWDGTLRFYDVPANQL-RQKFVQDAPLLDC-----AFMDIVHVVSGSLDNQ 77

  Fly    89 LQVLDM-----------EQPDLPVYNVKAHNGIINTIDAIGGTQIDCGAPEIVTGSRDGAVKVWD 142
            |::.|:           |:|...|.:.:..|||:                   |||.|..||:||
  Fly    78 LRLFDVNTQAESIIGAHEEPIRCVEHAEYVNGIL-------------------TGSWDNTVKLWD 123

  Fly   143 IRQGQAPVVDMSPPPQMGDGVNNSSGRRDCWAVAFGNTYN---AEERIVAAGYDNGDLKIFDLRS 204
            :|:.:.          :|....|:           |..|:   .:|:||.|..|...| |:|||.
  Fly   124 MREKRC----------VGTFEQNN-----------GKVYSMSVIDEKIVVATSDRKVL-IWDLRK 166

  Fly   205 LS---VRWEATMKNGICGLEFDRRDIPM--NK--LAVTTLEGGLLV--FDMRTQHPTKGFSYVEE 260
            :.   ::.|:::|       :..|.|.:  ||  ..::::||.:.|  .|...:...:.|::...
  Fly   167 MDSYIMKRESSLK-------YQTRCIRLFPNKEGYVMSSIEGRVAVEYLDHDPEVQRRKFAFKCH 224

  Fly   261 RNAGRSVGTNGVISGPKATVWVVRHLPQNR--DLFLTGGGTGSIRLW------------QYEYPD 311
            ||..:::          ..::.|..|..:.  ..|.|||..|.:.:|            :|:...
  Fly   225 RNREQNI----------EQIYPVNALSFHNVYQTFATGGSDGIVNIWDGFNKKRLCQFHEYDTSI 279

  Fly   312 RRVIDDSDGNKLGV 325
            ..:...|||:.|.:
  Fly   280 STLNFSSDGSALAI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr92NP_649025.1 WD40 <2..354 CDD:225201 70/339 (21%)
WD40 77..366 CDD:295369 59/286 (21%)
WD40 repeat 111..165 CDD:293791 10/53 (19%)
WD40 repeat 173..210 CDD:293791 12/42 (29%)
WD40 repeat 217..256 CDD:293791 8/44 (18%)
WD40 repeat 280..333 CDD:293791 13/60 (22%)
WD40 repeat 342..366 CDD:293791
Bub3NP_001287587.1 WD40 <10..296 CDD:225201 70/339 (21%)
WD40 16..262 CDD:295369 64/306 (21%)
WD40 repeat 16..53 CDD:293791 8/34 (24%)
WD40 repeat 59..93 CDD:293791 6/38 (16%)
WD40 repeat 98..134 CDD:293791 14/64 (22%)
WD40 repeat 141..175 CDD:293791 11/34 (32%)
WD40 repeat 182..222 CDD:293791 9/39 (23%)
WD40 repeat 237..283 CDD:293791 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10971
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.