DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr92 and CG12782

DIOPT Version :9

Sequence 1:NP_649025.1 Gene:Wdr92 / 39997 FlyBaseID:FBgn0036771 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_611772.2 Gene:CG12782 / 37685 FlyBaseID:FBgn0034838 Length:336 Species:Drosophila melanogaster


Alignment Length:323 Identity:66/323 - (20%)
Similarity:102/323 - (31%) Gaps:126/323 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QVLDMEQPDLPVYNVKAHNGIINTIDAIGGTQIDCGAPEIVTGSRDGAVKVWDIRQGQAPVVDMS 154
            |..|.|.|:.|          .:||.|:..:........|..||.|..|::|:::      .|..
  Fly    11 QQQDYELPNPP----------NDTISALEFSPRSSSWNAICAGSWDNTVRIWEVQ------ADRL 59

  Fly   155 PPPQMGDGVNNSSGRRDCWAVAFGNTYNAEERIVAAGYDNGDLKIFDLRSLSVR----------- 208
            .|..|    |:..|      ..|..|:|.....|.....:|.:..:||.|..:|           
  Fly    60 VPKVM----NSLEG------TPFDVTWNDSGNKVYLSDSSGQVTEWDLESNQLRKVGLHARAART 114

  Fly   209 ------------WEATMK--NGICGLEFDRRDIP--------MNKLAVT----------TLEGGL 241
                        |:.:::  :....:|..|.::|        :|.:||.          ||.|| 
  Fly   115 CHWVGPYLATTSWDKSIRFWDPRAAIELTRMELPDRSYAADVLNDVAVVACGDRSILAYTLRGG- 178

  Fly   242 LVFDMRTQHPTKGFSYVEERNAGRSVGTNGVISGPKATVWVVRHLPQNRDLFLTGGGTGSIRLWQ 306
            .|...|.:.|.:..:.|      |||.                 |.|||||          ..|.
  Fly   179 PVEQGRMKSPGESNTQV------RSVA-----------------LHQNRDL----------TSWL 210

  Fly   307 YEYPDRRVIDDSDGNKL-------------GVAGA-------LNMLS--AATLSSQPVHCFDW 347
            ....:..|.|.|..::.             |:...       :||::  .||:.|..|.|| |
  Fly   211 IAKTNGMVFDQSMAHRTVSFPIRCHRRENSGILDVYAVNEVKVNMVTQHIATVGSDGVFCF-W 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr92NP_649025.1 WD40 <2..354 CDD:225201 66/323 (20%)
WD40 77..366 CDD:295369 66/323 (20%)
WD40 repeat 111..165 CDD:293791 12/53 (23%)
WD40 repeat 173..210 CDD:293791 9/59 (15%)
WD40 repeat 217..256 CDD:293791 13/56 (23%)
WD40 repeat 280..333 CDD:293791 13/72 (18%)
WD40 repeat 342..366 CDD:293791 4/6 (67%)
CG12782NP_611772.2 WD40 <19..303 CDD:225201 62/315 (20%)
WD40 25..303 CDD:295369 60/299 (20%)
WD40 repeat 26..64 CDD:293791 9/43 (21%)
WD40 repeat 71..101 CDD:293791 8/29 (28%)
WD40 repeat 109..146 CDD:293791 3/36 (8%)
WD40 repeat 195..235 CDD:293791 14/72 (19%)
WD40 repeat 242..272 CDD:293791 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10971
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.