DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prestin and LOC1274251

DIOPT Version :10

Sequence 1:NP_649024.1 Gene:Prestin / 39996 FlyBaseID:FBgn0036770 Length:742 Species:Drosophila melanogaster
Sequence 2:XP_313342.6 Gene:LOC1274251 / 1274251 VectorBaseID:AGAMI1_006665 Length:608 Species:Anopheles gambiae


Alignment Length:49 Identity:13/49 - (26%)
Similarity:21/49 - (42%) Gaps:13/49 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FTKERH-----WLGTF--------DTAEEAAFAYDVAARSISGSLATTN 75
            |||..|     :||.|        :|:....:..::|..::.|.|.|.|
Mosquito   349 FTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrestinNP_649024.1 PRK11660 82..731 CDD:481320
LOC1274251XP_313342.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.