DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and TSPAN18

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_005253274.1 Gene:TSPAN18 / 90139 HGNCID:20660 Length:258 Species:Homo sapiens


Alignment Length:254 Identity:76/254 - (29%)
Similarity:122/254 - (48%) Gaps:37/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTN--LFSGAVYVLLVTSIIICLV 72
            |...:||.:|:.||.||:|||.:..:.:|.:||.:...|::..|  |.:|| |:||....::.|:
Human    15 CLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGA-YILLAMGGLLFLL 78

  Fly    73 SFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERV-QQTMRQEMRSTMALYGSRRE 136
            .||||.||.:|.|||||.:|:.:.::|:..|...:|.::|||.: ::...:|:............
Human    79 GFLGCCGAVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREFFTKELTKHYQGNNDTDV 143

  Fly   137 ITQAWDLTQERLQCCGVDTWHDWNRYGP------------------VPESCC----QELFGG--Q 177
            .:..|:.......||||:        ||                  |||:||    |...|.  .
Human   144 FSATWNSVMITFGCCGVN--------GPEDFKFASVFRLLTLDSEEVPEACCRREPQSRDGVLLS 200

  Fly   178 RKECTIFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMIE 236
            |:||.:..::. |..|||..|..|....:..:.|..:|.|..:.:|.|||:..||..|:
Human   201 REECLLGRSLF-LNKQGCYTVILNTFETYVYLAGALAIGVLAIELFAMIFAMCLFRGIQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 72/243 (30%)
TSPAN18XP_005253274.1 Tetraspannin 20..253 CDD:395265 72/242 (30%)
uroplakin_I_like_LEL 115..228 CDD:239409 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.