DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and TSPAN4

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_011518638.1 Gene:TSPAN4 / 7106 HGNCID:11859 Length:269 Species:Homo sapiens


Alignment Length:211 Identity:55/211 - (26%)
Similarity:107/211 - (50%) Gaps:10/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSFLGCVGAGKEVKCLLLTY 91
            :||..|..:.:|....:.....|..:.....|..:|::|...:..:.|:||:||.||.||||||:
Human    53 LGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTF 117

  Fly    92 FIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREI--TQAWDLTQERLQCCGVD 154
            |:::.|||:......:|.:.:.:::.:..:|:::..:.|||::..:  |.||.:.|...:||||.
Human   118 FLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVS 182

  Fly   155 TWHDW-NRYGP--VPESCCQELFGGQRKECTIFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIA 216
            .:.|| ..|..  ||:|||.|.    .:.|.:....| .:...|......:::::...:|...:.
Human   183 NYTDWFEVYNATRVPDSCCLEF----SESCGLHAPGT-WWKAPCYETVKVWLQENLLAVGIFGLC 242

  Fly   217 VAILMIFGMIFSCLLF 232
            .|::.|.|:.|:..::
Human   243 TALVQILGLTFAMTMY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 55/208 (26%)
TSPAN4XP_011518638.1 Tetraspannin 63..261 CDD:278750 52/201 (26%)
NET-5_like_LEL 136..233 CDD:239418 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.