DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and TSPAN8

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001356689.1 Gene:TSPAN8 / 7103 HGNCID:11855 Length:237 Species:Homo sapiens


Alignment Length:240 Identity:70/240 - (29%)
Similarity:123/240 - (51%) Gaps:31/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKYSLFIANFVIFVGGAIVFCLTLWTLVDRS----FVNELLGTNLFSGAVYVLLVTSIIICLVSF 74
            :|||:|..||:.::.|.::..|.:|..|...    |.:|.:|::.:. ||.:|:....||.::.|
Human     8 IKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYV-AVDILIAVGAIIMILGF 71

  Fly    75 LGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRER----VQQTMRQEMRSTMALYGSRR 135
            |||.||.||.:|:||.:||.:.|:.:..:..|:||.||:.:    |.:|:.:..:...|...|.:
Human    72 LGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEK 136

  Fly   136 EITQAWDLTQERLQCCG-VDTWHDW-NRYGPVPESC--------CQELFGGQRKECTIFPTITNL 190
            :..:|..:.||..:||| |:...|| |.:...||.|        ||...|.|            :
Human   137 QFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQ------------V 189

  Fly   191 YNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235
            |.:.|:....:|:..:..::.|.|..:|::.|.|::||.:|:..|
Human   190 YKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 68/234 (29%)
TSPAN8NP_001356689.1 Tetraspannin 8..230 CDD:334016 68/234 (29%)
TM4SF3_like_LEL 106..206 CDD:239407 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.