DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tspan4

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_030098725.1 Gene:Tspan4 / 64540 MGIID:1928097 Length:333 Species:Mus musculus


Alignment Length:234 Identity:65/234 - (27%)
Similarity:115/234 - (49%) Gaps:22/234 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSF 74
            |.|.|||.:|..|.:.::||..|..:.:|....:.....|..:.....|..:|:||...:..:.|
Mouse   100 CLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLSSSFPSLSAANLLIVTGTFVMAIGF 164

  Fly    75 LGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREI-- 137
            :||:||.||.||||||:|:::.|||:......||.:.:.:::....:|:::..:.|||::..:  
Mouse   165 VGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLFFAYSDKIDSYAQQDLKKGLHLYGTQGNVGL 229

  Fly   138 TQAWDLTQERLQCCGVDTWHDW-NRYGP--VPESCCQELFGGQRKECTIFPTITNLYNQG----- 194
            |.||.:.|...:||||..:.|| ..|..  ||:|||.|           |.....|:..|     
Mouse   230 TNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLE-----------FSDSCGLHEPGTWWKS 283

  Fly   195 -CLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLF 232
             |......:::::...:|...:..|::.|.|:.|:..::
Mouse   284 PCYETVKAWLQENLLAVGIFGLCTALVQILGLTFAMTMY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 63/227 (28%)
Tspan4XP_030098725.1 Tetraspannin 104..321 CDD:366035 63/227 (28%)
NET-5_like_LEL 200..297 CDD:239418 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.